Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|378
Gene name
LocationContig_1072:1029..3639
Strand-
Gene length (bp)2610
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 8.7E-169 104 754

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 12 800 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 29 781 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 83 780 9.0E-156
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 71 783 7.0E-155
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 83 791 2.0E-152
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 12 800 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 29 781 0.0E+00
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 83 780 9.0E-156
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 71 783 7.0E-155
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 83 791 2.0E-152
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 71 783 5.0E-150
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 20 780 4.0E-149
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 85 783 3.0E-146
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 74 795 2.0E-145
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 73 795 7.0E-143
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 72 783 5.0E-138
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 89 791 1.0E-130
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 37 772 3.0E-118
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 21 783 6.0E-97
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 106 128 22
2 133 155 22
3 210 232 22
4 236 258 22
5 279 301 22
6 321 343 22
7 352 374 22
8 428 450 22
9 480 497 17
10 507 529 22
11 536 558 22
12 589 611 22
13 656 678 22
14 701 723 22
15 736 758 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|378
MGFKDRFRVKASETPVDSAESTGAEILPSVSADHNPDRELRRFRKQHKWDPFLDIDKLDNIDDALASGNAEKEAA
VDESLIQEDSPYPEVRASVPPHDIDMPVNTLRAWVIGGFLCTVVAACNILLNLRRTPISITSTVVQLIAYPMGVG
WARFVPEKSFRIFGYTLELNPCPFNVKEHTIITMMTAAGSSISYSIDILLAQEIFYKQEFKWGFQILLMLSTQAM
GFGIAGIARRFLVWPSSMVWPATLITCSVMYSLHDHRASDPSETNGWRIGRYKFFLLVALVTFTWEWFPLVIAPF
LSLFLFATWIAPTNVVVNQIFGGQSGLGLLPISFDWSVVTAFLNSPLQTPAFAIFNVCAGIMLTTVGAIGLAWAG
PEFYRYLPLSANQNFDRFAEPYNTSRILTPDFTVNETAYKAYSPILLGPTFSLSYGLSFATLISTVTHVALFYGA
DVWNRAWDSKYEEPDVHLKLMRKYKEAPEWWFLSIFAVSFAFGMIASQVWKTHLPWWAYIICILIGVVLFIPIGM
VQAITNQQTGLNVITEMIVGYMMPGRPVAMMLFKSWGYMLSYNGLNYISDMKVGHYMKIPPRSMFAAQAFAVVWL
SFVQISTYNFLRGNIKGICTKEQAQGLTCPNARTFYNASVIWGVIGPAKVFGAGSIYAWTNWFWLIGFAVPVIQW
AAARRYPRSWARYLVSPALFGAAGMIPPATLFYLFQWVIVGLIFNFFIRRRFFGWWTRYNYPLSGALDIGTALCT
VISGLGLGLSETQFPRWWGTDVVGNTLDANSTAVTKTFMEGQAPIGPSSW*
Coding >Hirsu2|378
ATGGGCTTCAAGGACCGCTTTCGCGTCAAGGCGAGCGAGACGCCCGTTGACAGCGCCGAGTCGACGGGCGCCGAG
ATCCTGCCCTCCGTCTCCGCCGACCACAACCCGGACCGCGAGCTGCGCCGCTTCCGCAAGCAGCACAAGTGGGAT
CCCTTCCTCGACATCGACAAGCTCGACAACATCGACGATGCCCTCGCCTCGGGCAACGCCGAGAAGGAGGCCGCC
GTCGACGAGTCGCTCATCCAGGAGGACTCGCCCTACCCCGAAGTCCGCGCCTCGGTGCCGCCCCACGACATCGAC
ATGCCCGTCAACACCCTCCGCGCCTGGGTCATCGGCGGTTTTCTCTGCACCGTCGTCGCCGCCTGCAACATCCTC
CTCAACCTGCGGCGCACCCCCATCTCCATCACCTCCACCGTCGTCCAGCTGATCGCGTACCCGATGGGCGTCGGC
TGGGCGAGATTCGTGCCGGAAAAGTCGTTTCGCATCTTCGGCTACACCCTCGAGCTGAATCCCTGCCCCTTCAAC
GTCAAGGAGCACACCATCATCACCATGATGACGGCCGCCGGCTCCTCCATCAGCTACTCCATCGACATCCTGCTC
GCCCAGGAAATCTTCTACAAGCAAGAGTTCAAGTGGGGCTTCCAGATCCTGCTCATGCTGTCTACCCAGGCCATG
GGCTTCGGCATCGCCGGCATCGCCCGCCGCTTCCTCGTCTGGCCCTCGTCCATGGTCTGGCCCGCCACCCTCATC
ACCTGCTCCGTCATGTACTCGCTGCACGACCACCGGGCCTCGGACCCGTCCGAGACCAACGGCTGGCGCATCGGC
CGCTACAAGTTCTTCCTGCTTGTCGCCCTCGTCACCTTCACCTGGGAGTGGTTCCCCCTCGTCATCGCCCCCTTC
CTCTCCCTCTTCCTCTTCGCCACCTGGATCGCGCCGACCAACGTCGTCGTCAACCAAATCTTCGGCGGCCAGTCC
GGCCTCGGCCTGCTGCCCATCTCCTTCGACTGGTCCGTCGTCACCGCCTTCCTCAACTCGCCGCTGCAGACGCCG
GCCTTTGCCATCTTCAACGTCTGCGCCGGCATCATGCTCACCACCGTCGGCGCCATCGGCCTCGCCTGGGCCGGC
CCCGAGTTCTACCGCTACCTGCCCCTCAGCGCCAACCAGAACTTCGACCGCTTCGCCGAGCCCTACAACACGAGC
CGCATCCTGACGCCCGACTTCACCGTCAACGAGACGGCCTACAAGGCCTACTCGCCCATCCTGCTCGGGCCCACC
TTCTCGCTCTCGTACGGCCTCTCCTTCGCCACCCTCATCTCCACCGTCACCCACGTCGCCCTCTTCTACGGCGCC
GACGTCTGGAACCGCGCCTGGGACTCCAAGTACGAGGAGCCCGACGTCCACCTCAAGCTCATGCGCAAGTACAAG
GAGGCCCCCGAGTGGTGGTTCCTGTCCATCTTCGCCGTCAGCTTCGCCTTCGGCATGATTGCCTCCCAGGTCTGG
AAGACGCACCTGCCCTGGTGGGCCTACATCATCTGCATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATG
GTCCAGGCCATCACCAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATCGTCGGCTACATGATGCCCGGC
CGCCCCGTCGCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTCAACTACATCTCGGAC
ATGAAGGTCGGCCACTACATGAAGATTCCGCCCCGCAGCATGTTCGCCGCCCAGGCCTTCGCCGTCGTCTGGCTC
TCCTTCGTCCAGATCTCCACCTACAACTTCCTGCGCGGCAACATCAAGGGTATCTGCACCAAGGAGCAGGCCCAG
GGCCTGACGTGCCCCAACGCCCGCACCTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGCCCGGCCAAGGTC
TTCGGCGCCGGCAGCATCTACGCCTGGACCAACTGGTTCTGGCTCATCGGCTTCGCCGTGCCCGTCATCCAGTGG
GCGGCCGCCCGCCGCTACCCGCGCTCCTGGGCCCGCTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATG
ATCCCGCCCGCCACCCTCTTCTACCTCTTCCAGTGGGTCATCGTCGGCCTCATCTTCAACTTCTTCATCCGCAGG
CGCTTCTTTGGCTGGTGGACGCGCTACAACTATCCGCTCTCGGGCGCCCTCGACATCGGGACCGCCCTGTGCACC
GTCATCTCCGGGCTCGGCCTGGGCCTGAGCGAGACGCAGTTCCCCCGGTGGTGGGGCACCGACGTGGTCGGCAAC
ACGCTCGACGCCAACAGCACCGCCGTCACCAAGACGTTTATGGAAGGCCAGGCGCCCATCGGACCCTCGAGCTGG
TAG
Transcript >Hirsu2|378
ATGGGCTTCAAGGACCGCTTTCGCGTCAAGGCGAGCGAGACGCCCGTTGACAGCGCCGAGTCGACGGGCGCCGAG
ATCCTGCCCTCCGTCTCCGCCGACCACAACCCGGACCGCGAGCTGCGCCGCTTCCGCAAGCAGCACAAGTGGGAT
CCCTTCCTCGACATCGACAAGCTCGACAACATCGACGATGCCCTCGCCTCGGGCAACGCCGAGAAGGAGGCCGCC
GTCGACGAGTCGCTCATCCAGGAGGACTCGCCCTACCCCGAAGTCCGCGCCTCGGTGCCGCCCCACGACATCGAC
ATGCCCGTCAACACCCTCCGCGCCTGGGTCATCGGCGGTTTTCTCTGCACCGTCGTCGCCGCCTGCAACATCCTC
CTCAACCTGCGGCGCACCCCCATCTCCATCACCTCCACCGTCGTCCAGCTGATCGCGTACCCGATGGGCGTCGGC
TGGGCGAGATTCGTGCCGGAAAAGTCGTTTCGCATCTTCGGCTACACCCTCGAGCTGAATCCCTGCCCCTTCAAC
GTCAAGGAGCACACCATCATCACCATGATGACGGCCGCCGGCTCCTCCATCAGCTACTCCATCGACATCCTGCTC
GCCCAGGAAATCTTCTACAAGCAAGAGTTCAAGTGGGGCTTCCAGATCCTGCTCATGCTGTCTACCCAGGCCATG
GGCTTCGGCATCGCCGGCATCGCCCGCCGCTTCCTCGTCTGGCCCTCGTCCATGGTCTGGCCCGCCACCCTCATC
ACCTGCTCCGTCATGTACTCGCTGCACGACCACCGGGCCTCGGACCCGTCCGAGACCAACGGCTGGCGCATCGGC
CGCTACAAGTTCTTCCTGCTTGTCGCCCTCGTCACCTTCACCTGGGAGTGGTTCCCCCTCGTCATCGCCCCCTTC
CTCTCCCTCTTCCTCTTCGCCACCTGGATCGCGCCGACCAACGTCGTCGTCAACCAAATCTTCGGCGGCCAGTCC
GGCCTCGGCCTGCTGCCCATCTCCTTCGACTGGTCCGTCGTCACCGCCTTCCTCAACTCGCCGCTGCAGACGCCG
GCCTTTGCCATCTTCAACGTCTGCGCCGGCATCATGCTCACCACCGTCGGCGCCATCGGCCTCGCCTGGGCCGGC
CCCGAGTTCTACCGCTACCTGCCCCTCAGCGCCAACCAGAACTTCGACCGCTTCGCCGAGCCCTACAACACGAGC
CGCATCCTGACGCCCGACTTCACCGTCAACGAGACGGCCTACAAGGCCTACTCGCCCATCCTGCTCGGGCCCACC
TTCTCGCTCTCGTACGGCCTCTCCTTCGCCACCCTCATCTCCACCGTCACCCACGTCGCCCTCTTCTACGGCGCC
GACGTCTGGAACCGCGCCTGGGACTCCAAGTACGAGGAGCCCGACGTCCACCTCAAGCTCATGCGCAAGTACAAG
GAGGCCCCCGAGTGGTGGTTCCTGTCCATCTTCGCCGTCAGCTTCGCCTTCGGCATGATTGCCTCCCAGGTCTGG
AAGACGCACCTGCCCTGGTGGGCCTACATCATCTGCATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATG
GTCCAGGCCATCACCAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATCGTCGGCTACATGATGCCCGGC
CGCCCCGTCGCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTCAACTACATCTCGGAC
ATGAAGGTCGGCCACTACATGAAGATTCCGCCCCGCAGCATGTTCGCCGCCCAGGCCTTCGCCGTCGTCTGGCTC
TCCTTCGTCCAGATCTCCACCTACAACTTCCTGCGCGGCAACATCAAGGGTATCTGCACCAAGGAGCAGGCCCAG
GGCCTGACGTGCCCCAACGCCCGCACCTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGCCCGGCCAAGGTC
TTCGGCGCCGGCAGCATCTACGCCTGGACCAACTGGTTCTGGCTCATCGGCTTCGCCGTGCCCGTCATCCAGTGG
GCGGCCGCCCGCCGCTACCCGCGCTCCTGGGCCCGCTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATG
ATCCCGCCCGCCACCCTCTTCTACCTCTTCCAGTGGGTCATCGTCGGCCTCATCTTCAACTTCTTCATCCGCAGG
CGCTTCTTTGGCTGGTGGACGCGCTACAACTATCCGCTCTCGGGCGCCCTCGACATCGGGACCGCCCTGTGCACC
GTCATCTCCGGGCTCGGCCTGGGCCTGAGCGAGACGCAGTTCCCCCGGTGGTGGGGCACCGACGTGGTCGGCAAC
ACGCTCGACGCCAACAGCACCGCCGTCACCAAGACGTTTATGGAAGGCCAGGCGCCCATCGGACCCTCGAGCTGG
TAG
Gene >Hirsu2|378
ATGGGCTTCAAGGACCGCTTTCGCGTCAAGGCGAGCGAGACGCCCGTTGACAGCGCCGAGTCGACGGGCGCCGAG
ATCCTGCCCTCCGTCTCCGCCGACCACAACCCGGACCGCGAGCTGCGCCGCTTCCGCAAGCAGCACAAGTGGGAT
CCCTTCCTCGACATCGACAAGCTCGACAACATCGACGATGCCCTCGCCTCGGGCAACGCCGAGAAGGAGGCCGCC
GTCGACGAGTCGCTCATCCAGGAGGACTCGCCCTACCCCGAAGTCCGCGCCTCGGTGAGCGCGCCCCGCCGTCCG
GGTCCGCCCACGCTTCCTGCTGACCTCGCCCGCTCCCCAGGTGCCGCCCCACGACATCGACATGCCCGTCAACAC
CCTCCGCGCCTGGGTCATCGGCGGTTTTCTCTGCACCGTCGTCGCCGCCTGCAACATCCTCCTCAACCTGCGGCG
CACCCCCATCTCCATCACCTCCACCGTCGTCCAGCTGATCGCGTACCCGTGAGTGCCTCCCTCGAGCCAATCCCC
CCCCCTTTCCGCCGCGACGACCCAATTGACCTCGCTCTTTTCTCCCCGCGCACAGGATGGGCGTCGGCTGGGCGA
GATTCGTGCCGGAAAAGTCGTTTCGCATCTTCGGCTACACCCTCGAGCTGAATCCCTGCCCCTTCAACGTCAAGG
AGCACACCATCATCACCATGATGACGGCCGCCGGCTCCTCCATCAGCTACTCCATCGACATCCTGCTCGCCCAGG
AAATCTTCTACAAGCAAGAGTTCAAGTGGGGCTTCCAGATCCTGCTCATGCTGTCTACCCAGGCCATGGGCTTCG
GCATCGCCGGCATCGCCCGCCGCTTCCTCGTCTGGCCCTCGTCCATGGTCTGGCCCGCCACCCTCATCACCTGCT
CCGTCATGTACTCGCTGCACGACCACCGGGCCTCGGACCCGTCCGAGACCAACGGCTGGCGCATCGGCCGCTACA
AGTTCTTCCTGCTTGTCGCCCTCGTCACCTTCACCTGGGAGTGGTTCCCCCTCGTCATCGCCCCCTTCCTCTCCC
TCTTCCTCTTCGCCACCTGGATCGCGCCGACCAACGTCGTCGTCAACCAAATCTTCGGCGGCCAGTCCGGCCTCG
GCCTGCTGCCCATCTCCTTCGACTGGTCCGTCGTCACCGCCTTCCTCAACTCGCCGCTGCAGACGCCGGCCTTTG
CCATCTTCAACGTCTGCGCCGGCATCATGCTCACCACCGTCGGCGCCATCGGCCTCGCCTGGGCCGGCCCCGAGT
TCTACCGCTACCTGCCCCTCAGCGCCAACCAGAACTTCGACCGCTTCGCCGAGCCCTACAACACGAGCCGCATCC
TGACGCCCGACTTCACCGTCAACGAGACGGCCTACAAGGCCTACTCGCCCATCCTGCTCGGGCCCACCTTCTCGC
TCTCGTACGGCCTCTCCTTCGCCACCCTCATCTCCACCGTCACCCACGTCGCCCTCTTCTACGGCGCCGACGTCT
GGAACCGCGCCTGGGACTCCAAGTACGAGGAGCCCGACGTCCACCTCAAGCTCATGCGCAAGTACAAGGAGGCCC
CCGAGTGGTGGTTCCTGTCCATCTTCGCCGTCAGCTTCGCCTTCGGCATGATTGCCTCCCAGGTCTGGAAGACGC
ACCTGCCCTGGTGGGCCTACATCATCTGCATCCTCATCGGCGTCGTCCTCTTCATCCCCATCGGCATGGTCCAGG
CCATCACCAACCAGCAGACGGGCCTCAACGTCATCACCGAGATGATCGTCGGCTACATGATGCCCGGCCGCCCCG
TCGCCATGATGCTCTTCAAGTCGTGGGGCTACATGCTGTCCTACAACGGCCTCAACTACATCTCGGACATGAAGG
TCGGCCACTACATGAAGATTCCGCCCCGCAGCATGTTCGCCGCCCAGGCCTTCGCCGTCGTCTGGCTCTCCTTCG
TCCAGATCTCCACCTACAACTTCCTGCGCGGCAACATCAAGGGTATCTGCACCAAGGAGCAGGCCCAGGGCCTGA
CGTGCCCCAACGCCCGCACCTTTTACAACGCCAGCGTCATCTGGGGCGTCATCGGCCCGGCCAAGGTCTTCGGCG
CCGGCAGCATCTACGCCTGGACCAACTGGTTCTGGCTCATCGGCTTCGCCGTGCCCGTCATCCAGTGGGCGGCCG
CCCGCCGCTACCCGCGCTCCTGGGCCCGCTACCTCGTCTCGCCCGCCCTGTTCGGCGCCGCCGGCATGATCCCGC
CCGCCACCCTCTTCTACCTCTTCCAGTGGGTCATCGTCGGCCTCATCTTCAACTTCTTCATCCGCAGGCGCTTCT
TTGGCTGGTGGAGTAAGTGTGCCCCCTTCCCGCGCCCCGGTCACGGTGGTCTCGAGGCTGACGGTGCGCTCGGCA
GCGCGCTACAACTATCCGCTCTCGGGCGCCCTCGACATCGGGACCGCCCTGTGCACCGTCATCTCCGGGCTCGGC
CTGGGCCTGAGCGAGACGCAGTTCCCCCGGTGGTGGGGCACCGACGTGGTCGGCAACACGCTCGACGCCAACAGC
ACCGCCGTCACCAAGACGTTTATGGAAGGCCAGGCGCCCATCGGACCCTCGAGCTGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail