Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3776
Gene name
LocationContig_2002:1699..3583
Strand+
Gene length (bp)1884
Transcript length (bp)1665
Coding sequence length (bp)1665
Protein length (aa) 555

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4544 0.5972 0.1258 0.1984 0.1227 0.0113 0.0224 0.0336 0.0051 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2549
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2241
Ophiocordyceps australis map64 (Brazil) OphauB2|5099
Ophiocordyceps camponoti-floridani Ophcf2|00782
Ophiocordyceps camponoti-rufipedis Ophun1|5258
Ophiocordyceps kimflemingae Ophio5|2610
Ophiocordyceps subramaniannii Hirsu2|3776 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3776
MSHRGGRVTDFEERDYYPPPRRSAPDLDDLDYRPRAAARTPQPRSRVATREQDEVDIRLVDRTPAFLRDDARRPE
AGPMVLRQRDVETFDRHAPRSPSPPVRIRELVRRPKSASPPAMRGSEHEHSRTRIYERERERDREPVRSPSVVRR
RSPSPLPVRFVERRRRSPEPAAHEHIRTRIVEKERERFPSPSPSPSPPPPPPPPPVIRGPTIEREVITHWTDVDH
GVVRARPPSPPPPPAPRPRPRERETDIDISLSKNRTEVDIYQSSGPARSGSRERRSRYREDDIVVRRDSDRLKVD
ESRRRARSAAPLGSPNAVDDEADYLTSKLDSRGRMGEAWGGATKDWTIVDVPPGTERVRMDGVGGASTDTTWTRY
SGVRRTQFIPERDGVLVPREPSPAPSRDRSSVTVYDREREIDVDIDRRVTRTPLPQPPPPPKEMWTEITKDLVLR
EAIEHMGYEYEETKWFFYIMDYLRYDDVLRLTELSDEIRRVRKERVREIQFERDWRDEWERPFRRHLPDHHDHWR
SSRDEWDDERVREREVVYDSRRPARGYMR*
Coding >Hirsu2|3776
ATGTCGCACCGAGGCGGCAGGGTGACCGACTTCGAGGAGCGCGACTACTACCCGCCTCCTCGTCGCTCGGCCCCC
GACCTGGATGACTTGGACTACCGTCCTCGTGCCGCCGCGCGAACGCCCCAGCCACGGTCCCGTGTCGCCACGCGC
GAGCAGGACGAGGTCGACATCCGCCTCGTCGACCGCACCCCGGCCTTCTTAAGAGACGACGCCCGCCGCCCCGAG
GCCGGGCCCATGGTCCTGCGCCAGCGCGACGTCGAGACCTTCGACCGCCACGCCCCGAGGAGCCCCAGCCCGCCC
GTCCGCATCCGCGAGCTCGTCCGCCGCCCCAAGAGCGCCTCCCCGCCCGCCATGCGCGGCAGCGAGCACGAGCAC
TCGCGCACCCGCATCTACGAGAGGGAGAGGGAGCGCGACCGGGAGCCCGTCCGCAGCCCGTCCGTCGTCCGCCGC
CGCTCGCCCTCGCCCCTGCCCGTCCGCTTCGTCGAGCGCCGCCGCCGCTCGCCCGAGCCCGCCGCCCACGAACAC
ATCCGCACCCGCATCGTCGAAAAGGAGCGCGAGCGCTTCCCCTCGCCCTCGCCTTCTCCCTCGCCCCCGCCCCCG
CCTCCGCCCCCGCCCGTCATCCGCGGCCCGACCATCGAGCGCGAGGTCATCACCCACTGGACCGATGTCGACCAC
GGCGTCGTGAGAGCCAGACCGCCGAGCCCGCCCCCGCCCCCGGCCCCTCGTCCGCGCCCGAGGGAGCGCGAGACG
GACATCGACATCTCCCTGTCCAAGAACCGCACCGAGGTCGACATCTACCAGTCCAGCGGCCCCGCCCGCTCCGGG
AGCCGCGAGCGCCGCTCGCGCTACCGCGAGGACGATATCGTCGTCCGCCGCGACAGCGACCGCCTCAAGGTCGAC
GAGTCGCGCCGCCGTGCCCGCTCCGCCGCCCCGCTCGGCTCCCCCAACGCCGTCGACGACGAGGCCGACTACCTC
ACCTCCAAGCTCGACTCGCGCGGCCGCATGGGCGAGGCCTGGGGCGGCGCCACCAAGGACTGGACCATCGTCGAC
GTGCCGCCCGGCACCGAGAGGGTGCGCATGGACGGCGTCGGCGGCGCCAGCACCGACACCACCTGGACCAGGTAC
AGCGGCGTGAGGCGCACCCAGTTCATCCCCGAGCGCGACGGCGTCCTCGTGCCGCGCGAGCCCTCGCCCGCCCCC
TCGCGCGACCGCTCGAGCGTGACCGTCTACGACCGCGAGAGGGAGATCGACGTCGACATCGACCGCCGCGTCACC
CGCACCCCGCTGCCGCAGCCGCCTCCGCCGCCCAAGGAGATGTGGACCGAGATCACCAAGGACCTCGTTCTGCGC
GAGGCCATCGAGCACATGGGCTACGAGTACGAGGAGACCAAATGGTTCTTTTACATCATGGACTACCTCCGATAC
GACGACGTCCTGCGCCTGACGGAGCTGTCGGACGAGATCCGCCGGGTGCGCAAGGAGCGCGTGCGCGAAATACAG
TTCGAGCGCGACTGGCGAGACGAGTGGGAGCGACCCTTCCGCCGCCACCTGCCGGACCACCACGACCACTGGCGC
TCGTCGCGCGACGAGTGGGACGACGAGCGCGTCCGGGAGCGCGAGGTCGTCTACGACAGCCGCCGGCCGGCCCGC
GGATACATGCGCTGA
Transcript >Hirsu2|3776
ATGTCGCACCGAGGCGGCAGGGTGACCGACTTCGAGGAGCGCGACTACTACCCGCCTCCTCGTCGCTCGGCCCCC
GACCTGGATGACTTGGACTACCGTCCTCGTGCCGCCGCGCGAACGCCCCAGCCACGGTCCCGTGTCGCCACGCGC
GAGCAGGACGAGGTCGACATCCGCCTCGTCGACCGCACCCCGGCCTTCTTAAGAGACGACGCCCGCCGCCCCGAG
GCCGGGCCCATGGTCCTGCGCCAGCGCGACGTCGAGACCTTCGACCGCCACGCCCCGAGGAGCCCCAGCCCGCCC
GTCCGCATCCGCGAGCTCGTCCGCCGCCCCAAGAGCGCCTCCCCGCCCGCCATGCGCGGCAGCGAGCACGAGCAC
TCGCGCACCCGCATCTACGAGAGGGAGAGGGAGCGCGACCGGGAGCCCGTCCGCAGCCCGTCCGTCGTCCGCCGC
CGCTCGCCCTCGCCCCTGCCCGTCCGCTTCGTCGAGCGCCGCCGCCGCTCGCCCGAGCCCGCCGCCCACGAACAC
ATCCGCACCCGCATCGTCGAAAAGGAGCGCGAGCGCTTCCCCTCGCCCTCGCCTTCTCCCTCGCCCCCGCCCCCG
CCTCCGCCCCCGCCCGTCATCCGCGGCCCGACCATCGAGCGCGAGGTCATCACCCACTGGACCGATGTCGACCAC
GGCGTCGTGAGAGCCAGACCGCCGAGCCCGCCCCCGCCCCCGGCCCCTCGTCCGCGCCCGAGGGAGCGCGAGACG
GACATCGACATCTCCCTGTCCAAGAACCGCACCGAGGTCGACATCTACCAGTCCAGCGGCCCCGCCCGCTCCGGG
AGCCGCGAGCGCCGCTCGCGCTACCGCGAGGACGATATCGTCGTCCGCCGCGACAGCGACCGCCTCAAGGTCGAC
GAGTCGCGCCGCCGTGCCCGCTCCGCCGCCCCGCTCGGCTCCCCCAACGCCGTCGACGACGAGGCCGACTACCTC
ACCTCCAAGCTCGACTCGCGCGGCCGCATGGGCGAGGCCTGGGGCGGCGCCACCAAGGACTGGACCATCGTCGAC
GTGCCGCCCGGCACCGAGAGGGTGCGCATGGACGGCGTCGGCGGCGCCAGCACCGACACCACCTGGACCAGGTAC
AGCGGCGTGAGGCGCACCCAGTTCATCCCCGAGCGCGACGGCGTCCTCGTGCCGCGCGAGCCCTCGCCCGCCCCC
TCGCGCGACCGCTCGAGCGTGACCGTCTACGACCGCGAGAGGGAGATCGACGTCGACATCGACCGCCGCGTCACC
CGCACCCCGCTGCCGCAGCCGCCTCCGCCGCCCAAGGAGATGTGGACCGAGATCACCAAGGACCTCGTTCTGCGC
GAGGCCATCGAGCACATGGGCTACGAGTACGAGGAGACCAAATGGTTCTTTTACATCATGGACTACCTCCGATAC
GACGACGTCCTGCGCCTGACGGAGCTGTCGGACGAGATCCGCCGGGTGCGCAAGGAGCGCGTGCGCGAAATACAG
TTCGAGCGCGACTGGCGAGACGAGTGGGAGCGACCCTTCCGCCGCCACCTGCCGGACCACCACGACCACTGGCGC
TCGTCGCGCGACGAGTGGGACGACGAGCGCGTCCGGGAGCGCGAGGTCGTCTACGACAGCCGCCGGCCGGCCCGC
GGATACATGCGCTGA
Gene >Hirsu2|3776
ATGTCGCACCGAGGCGGCAGGGTGACCGACTTCGAGGAGCGCGACTACTACCCGCCTCCTCGTCGCTCGGCCCCC
GACCTGGATGACTTGGACTACCGTCCTCGTGCCGCCGCGCGAACGCCCCAGCCACGGTCCCGTGTCGCCACGCGC
GAGCAGGACGAGGTCGACATCCGCCTCGTCGACCGCACCCCGGCCTTCTTAAGAGACGACGCCCGCCGCCCCGAG
GCCGGGCCCATGGTCCTGCGCCAGCGCGACGTCGAGACCTTCGACCGCCACGCCCCGAGGAGCCCCAGCCCGCCC
GTCCGCATCCGCGAGCTCGTCCGCCGCCCCAAGAGCGCCTCCCCGCCCGCCATGCGCGGCAGCGAGCACGAGCAC
TCGCGCACCCGCATCTACGAGAGGGAGAGGGAGCGCGACCGGGAGCCCGTCCGCAGCCCGTCCGTCGTCCGCCGC
CGCTCGCCCTCGCCCCTGCCCGTCCGCTTCGTCGAGCGCCGCCGCCGCTCGCCCGAGCCCGCCGCCCACGAACAC
ATCCGCACCCGCATCGTCGAAAAGGAGCGCGAGCGCTTCCCCTCGCCCTCGCCTTCTCCCTCGCCCCCGCCCCCG
CCTCCGCCCCCGCCCGTCATCCGCGGCCCGACCATCGAGCGCGAGGTCATCACCCACTGGACCGATGTCGACCAC
GGCGAGTGAAAGACAGAAGGAGAGCGAGACACGGACACTCGGCTGACCCCCCCGCCCGCCTTCTCCACCCCCCCC
CCCCCCCCCCCCTCGTCCAGGCGTCGTGAGAGCCAGACCGCCGAGCCCGCCCCCGCCCCCGGCCCCTCGTCCGCG
CCCGAGGGAGCGCGAGACGGACATCGACATCTCCCTGTCCAAGAACCGCACCGAGGTCGACATCTACCAGTCCAG
CGGCCCCGCCCGCTCCGGGAGCCGCGAGCGCCGCTCGCGCTACCGCGAGGACGATATCGTCGTCCGCCGCGACAG
CGACCGCCTCAAGGTCGACGAGTCGCGCCGCCGTGCCCGCTCCGCCGCCCCGCTCGGCTCCCCCAACGCCGTCGA
CGACGAGGCCGACTACCTCACCTCCAAGCTCGACTCGCGCGGCCGCATGGGCGAGGCCTGGGGCGGCGCCACCAA
GGACTGGACCATCGTCGACGTGCCGCCCGGCACCGAGAGGGTGCGCATGGACGGCGTCGGCGGCGCCAGCACCGA
CACCACCTGGACCAGGTACAGCGGCGTGAGGCGCACCCAGTTCATCCCCGAGCGCGACGGCGTCCTCGTGCCGCG
CGAGCCCTCGCCCGCCCCCTCGCGCGACCGCTCGAGCGTGACCGTCTACGACCGCGAGAGGGAGATCGACGTCGA
CATCGACCGCCGCGTCACCCGCACCCCGCTGCCGCAGCCGCCTCCGCCGCCCAAGGAGATGTGGACCGAGATCAC
CAAGGACCTCGTTCTGCGCGAGGCCATCGAGCACATGGGCTACGAGTACGAGGAGACCAAATGGTTCTTTTACAT
CATGGACTACCTCCGATACGTGAGTCGTCTTGTTTTTTTTCCCCCCTCCTCCTCTCCCTCCGACGGACCATGAAC
AACGACGAGAAGACACGACGGCAGTGCTGGCCAGCAGCTGACGTGCTCCGCCCCCCTTCCCCATTACAGGACGAC
GTCCTGCGCCTGACGGAGCTGTCGGACGAGATCCGCCGGGTGCGCAAGGAGCGCGTGCGCGAAATACAGTTCGAG
CGCGACTGGCGAGACGAGTGGGAGCGACCCTTCCGCCGCCACCTGCCGGACCACCACGACCACTGGCGCTCGTCG
CGCGACGAGTGGGACGACGAGCGCGTCCGGGAGCGCGAGGTCGTCTACGACAGCCGCCGGCCGGCCCGCGGATAC
ATGCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail