Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3769
Gene name
LocationContig_200:29802..30159
Strand-
Gene length (bp)357
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6351 0.4807 0.0458 0.1055 0.2722 0.0076 0.1378 0.2677 0.2356 0.0748

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup540
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7756
Ophiocordyceps australis map64 (Brazil) OphauB2|874
Ophiocordyceps camponoti-floridani Ophcf2|01378
Ophiocordyceps camponoti-rufipedis Ophun1|2602
Ophiocordyceps camponoti-rufipedis Ophun1|5926
Ophiocordyceps kimflemingae Ophio5|5493
Ophiocordyceps subramaniannii Hirsu2|3769 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4861

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3769
MRAEGWLHGRLARYAYLPPAVVGQLLWNLRHALFADSASQATTASAAASSPSGSEPAFLDHGASRASSVDIGSAP
APPPASQLLTRSQMLPESVLCDLAAVAAPGPEIGDSDSDGEPL*
Coding >Hirsu2|3769
ATGCGCGCCGAGGGCTGGCTGCACGGCCGCCTCGCCCGCTACGCCTACCTGCCGCCCGCCGTCGTCGGCCAGCTG
CTGTGGAACCTGCGCCACGCCCTCTTCGCCGACTCCGCCTCCCAGGCCACGACCGCCTCCGCCGCCGCCTCCTCC
CCCTCCGGCTCCGAGCCCGCCTTCCTCGACCACGGCGCCTCCCGCGCCTCCTCCGTCGACATCGGCTCCGCCCCC
GCCCCGCCCCCGGCCTCCCAGCTCCTGACGCGCAGCCAGATGCTGCCCGAGAGCGTCTTGTGCGACCTGGCCGCC
GTCGCCGCCCCCGGGCCCGAGATCGGCGACTCCGACTCGGACGGCGAGCCGCTGTGA
Transcript >Hirsu2|3769
ATGCGCGCCGAGGGCTGGCTGCACGGCCGCCTCGCCCGCTACGCCTACCTGCCGCCCGCCGTCGTCGGCCAGCTG
CTGTGGAACCTGCGCCACGCCCTCTTCGCCGACTCCGCCTCCCAGGCCACGACCGCCTCCGCCGCCGCCTCCTCC
CCCTCCGGCTCCGAGCCCGCCTTCCTCGACCACGGCGCCTCCCGCGCCTCCTCCGTCGACATCGGCTCCGCCCCC
GCCCCGCCCCCGGCCTCCCAGCTCCTGACGCGCAGCCAGATGCTGCCCGAGAGCGTCTTGTGCGACCTGGCCGCC
GTCGCCGCCCCCGGGCCCGAGATCGGCGACTCCGACTCGGACGGCGAGCCGCTGTGA
Gene >Hirsu2|3769
ATGCGCGCCGAGGGCTGGCTGCACGGCCGCCTCGCCCGCTACGCCTACCTGCCGCCCGCCGTCGTCGGCCAGCTG
CTGTGGAACCTGCGCCACGCCCTCTTCGCCGACTCCGCCTCCCAGGCCACGACCGCCTCCGCCGCCGCCTCCTCC
CCCTCCGGCTCCGAGCCCGCCTTCCTCGACCACGGCGCCTCCCGCGCCTCCTCCGTCGACATCGGCTCCGCCCCC
GCCCCGCCCCCGGCCTCCCAGCTCCTGACGCGCAGCCAGATGCTGCCCGAGAGCGTCTTGTGCGACCTGGCCGCC
GTCGCCGCCCCCGGGCCCGAGATCGGCGACTCCGACTCGGACGGCGAGCCGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail