Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3764
Gene name
LocationContig_200:13066..15497
Strand+
Gene length (bp)2431
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10360 DUF2433 Protein of unknown function (DUF2433) 1.8E-49 278 407
PF00149 Metallophos Calcineurin-like phosphoesterase 6.2E-04 41 152

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42947|YBPC_SCHPO Uncharacterized protein C16H5.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16H5.12c PE=1 SV=3 42 407 1.0E-121

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3764
MAAPRPYNNPGYLQNGATGLPQPGAAPLLPNQGRVIQTGPIRVLCIADVRGNLRSLNDLAKQARADHIIHTGDFG
FYDDTSLDRIVEKTLKHVAQYSPLISEPVKKAIQQGGNGPVKSRFAPQELPLSELPLLLSGELKLDVPVYTVWGA
CEDVRVLEKFRSSEYKVPNLHIIDEARSMLLEIGGVKLRLLGLGGAVVMHKLFDNGEGRTTIAGGQGTMWTTLLQ
MGELVDTAHRVYDPTETRIFITHASPAREGILNQLSVTLKADFSISAGLHFRYGSSYNEFSVNPTLDHYRGKLAA
SKASFNDVWETVKGEVEPAIQQNEAQQNLLKNALQIVEKMPTTAAGGNPFGGPAAGQAALGQVDESAFKNMWNFN
LADAAFGYLVLEIQDGRIGTEMRAQGFNFSHRGAKQQPGASTGPPPASAGGQPSPATTSAQLAPPPQTSRQPSQP
PKASAATPTSGGTKPGTPKPGPGTDSAGTASKDPEKTPAAANGSANGPELTASPAPKSLASDIIGLFIMNVSGEE
QCRDLFDEEDKGKIVRVEKWGMQNKVVHFKTPEERDAAMARLPDDVKTRTQEDRSKPLVKIFQHREGKAFTNRGG
AGNWGGNARGGSSASGYRSAGGTSDSESNRRGGRGGRGGRGGDRSRGGRGRGGIKGDTGTSSPAAPATPAAE*
Coding >Hirsu2|3764
ATGGCTGCTCCGCGACCGTACAACAATCCAGGTTATCTCCAAAACGGCGCCACGGGGCTTCCCCAGCCTGGGGCA
GCGCCTCTCCTGCCGAACCAAGGCCGCGTGATCCAGACCGGCCCCATCAGAGTGCTCTGCATTGCAGATGTTCGC
GGAAACCTGAGATCGCTCAACGACCTGGCTAAGCAGGCTCGCGCCGACCACATCATCCACACCGGCGACTTTGGC
TTCTACGACGATACCTCGCTGGACCGAATCGTGGAGAAAACACTCAAGCATGTGGCCCAATACTCGCCTCTCATC
TCCGAACCCGTCAAGAAGGCAATCCAACAAGGGGGCAACGGCCCCGTCAAGAGTCGGTTTGCTCCCCAGGAGCTG
CCCCTGTCGGAGCTGCCGCTCCTGCTCAGCGGAGAGCTCAAGCTAGACGTGCCCGTCTACACCGTCTGGGGCGCG
TGCGAGGACGTCCGTGTGTTGGAGAAATTCAGGTCCTCCGAGTACAAGGTGCCCAATCTGCACATCATCGACGAG
GCTCGCTCCATGCTCCTCGAAATCGGTGGCGTCAAGCTCAGGCTGCTTGGCCTCGGCGGTGCCGTCGTCATGCAC
AAGCTTTTTGACAATGGCGAGGGCCGTACCACCATTGCCGGTGGCCAGGGCACCATGTGGACTACTCTGCTGCAG
ATGGGAGAGCTTGTCGACACAGCCCATCGCGTTTACGACCCCACCGAGACCCGAATCTTCATCACACACGCATCG
CCCGCGCGCGAGGGCATCCTGAACCAGCTTTCCGTCACGCTCAAGGCCGACTTCTCCATTTCGGCCGGTCTCCAC
TTCCGGTACGGCAGCTCCTACAACGAATTCAGCGTCAACCCAACGCTGGACCACTACCGCGGGAAGCTCGCCGCC
TCCAAGGCCTCGTTCAACGACGTCTGGGAGACGGTCAAGGGAGAGGTTGAGCCCGCCATTCAGCAGAACGAGGCC
CAGCAGAATCTCCTCAAGAACGCGCTCCAGATTGTAGAGAAGATGCCCACCACGGCGGCCGGCGGTAACCCGTTT
GGTGGACCCGCTGCCGGTCAAGCTGCGCTCGGCCAGGTGGATGAGAGCGCATTCAAGAACATGTGGAACTTCAAC
CTCGCCGACGCAGCCTTTGGCTATCTCGTTTTGGAGATTCAAGACGGTCGCATCGGCACCGAGATGCGCGCACAG
GGCTTCAACTTCTCCCATCGCGGCGCAAAGCAACAGCCCGGCGCGTCGACTGGCCCTCCGCCGGCATCCGCGGGC
GGCCAACCTTCGCCCGCGACCACCTCTGCGCAGCTGGCACCCCCCCCGCAAACTAGCCGGCAGCCGTCCCAGCCG
CCCAAAGCATCGGCTGCGACGCCGACGTCTGGCGGCACAAAACCGGGAACCCCCAAGCCGGGCCCGGGCACAGAT
AGCGCCGGCACCGCCAGCAAAGACCCCGAGAAGACGCCCGCGGCGGCAAACGGATCCGCCAACGGCCCCGAGCTT
ACCGCATCGCCTGCCCCCAAGTCTCTTGCCTCGGACATCATCGGCCTGTTCATCATGAACGTCAGCGGTGAGGAA
CAGTGCCGGGACTTGTTTGATGAGGAAGACAAGGGCAAGATTGTCAGGGTGGAGAAGTGGGGGATGCAGAACAAG
GTGGTGCACTTCAAGACGCCTGAGGAACGAGACGCCGCCATGGCCCGACTGCCCGACGACGTCAAGACGCGAACC
CAAGAAGACCGGTCGAAGCCGCTGGTGAAGATCTTCCAGCACCGCGAGGGCAAGGCCTTCACCAACCGCGGTGGC
GCCGGCAACTGGGGAGGCAACGCTCGCGGAGGCAGCTCCGCGAGTGGTTATCGAAGCGCAGGGGGCACCAGCGAC
TCGGAAAGCAACCGCCGGGGCGGTCGCGGGGGTCGCGGGGGCCGCGGCGGCGACAGGAGCCGCGGAGGGCGAGGC
CGCGGAGGGATCAAGGGCGACACTGGCACTTCTTCTCCGGCAGCGCCGGCCACGCCGGCCGCCGAATGA
Transcript >Hirsu2|3764
ATGGCTGCTCCGCGACCGTACAACAATCCAGGTTATCTCCAAAACGGCGCCACGGGGCTTCCCCAGCCTGGGGCA
GCGCCTCTCCTGCCGAACCAAGGCCGCGTGATCCAGACCGGCCCCATCAGAGTGCTCTGCATTGCAGATGTTCGC
GGAAACCTGAGATCGCTCAACGACCTGGCTAAGCAGGCTCGCGCCGACCACATCATCCACACCGGCGACTTTGGC
TTCTACGACGATACCTCGCTGGACCGAATCGTGGAGAAAACACTCAAGCATGTGGCCCAATACTCGCCTCTCATC
TCCGAACCCGTCAAGAAGGCAATCCAACAAGGGGGCAACGGCCCCGTCAAGAGTCGGTTTGCTCCCCAGGAGCTG
CCCCTGTCGGAGCTGCCGCTCCTGCTCAGCGGAGAGCTCAAGCTAGACGTGCCCGTCTACACCGTCTGGGGCGCG
TGCGAGGACGTCCGTGTGTTGGAGAAATTCAGGTCCTCCGAGTACAAGGTGCCCAATCTGCACATCATCGACGAG
GCTCGCTCCATGCTCCTCGAAATCGGTGGCGTCAAGCTCAGGCTGCTTGGCCTCGGCGGTGCCGTCGTCATGCAC
AAGCTTTTTGACAATGGCGAGGGCCGTACCACCATTGCCGGTGGCCAGGGCACCATGTGGACTACTCTGCTGCAG
ATGGGAGAGCTTGTCGACACAGCCCATCGCGTTTACGACCCCACCGAGACCCGAATCTTCATCACACACGCATCG
CCCGCGCGCGAGGGCATCCTGAACCAGCTTTCCGTCACGCTCAAGGCCGACTTCTCCATTTCGGCCGGTCTCCAC
TTCCGGTACGGCAGCTCCTACAACGAATTCAGCGTCAACCCAACGCTGGACCACTACCGCGGGAAGCTCGCCGCC
TCCAAGGCCTCGTTCAACGACGTCTGGGAGACGGTCAAGGGAGAGGTTGAGCCCGCCATTCAGCAGAACGAGGCC
CAGCAGAATCTCCTCAAGAACGCGCTCCAGATTGTAGAGAAGATGCCCACCACGGCGGCCGGCGGTAACCCGTTT
GGTGGACCCGCTGCCGGTCAAGCTGCGCTCGGCCAGGTGGATGAGAGCGCATTCAAGAACATGTGGAACTTCAAC
CTCGCCGACGCAGCCTTTGGCTATCTCGTTTTGGAGATTCAAGACGGTCGCATCGGCACCGAGATGCGCGCACAG
GGCTTCAACTTCTCCCATCGCGGCGCAAAGCAACAGCCCGGCGCGTCGACTGGCCCTCCGCCGGCATCCGCGGGC
GGCCAACCTTCGCCCGCGACCACCTCTGCGCAGCTGGCACCCCCCCCGCAAACTAGCCGGCAGCCGTCCCAGCCG
CCCAAAGCATCGGCTGCGACGCCGACGTCTGGCGGCACAAAACCGGGAACCCCCAAGCCGGGCCCGGGCACAGAT
AGCGCCGGCACCGCCAGCAAAGACCCCGAGAAGACGCCCGCGGCGGCAAACGGATCCGCCAACGGCCCCGAGCTT
ACCGCATCGCCTGCCCCCAAGTCTCTTGCCTCGGACATCATCGGCCTGTTCATCATGAACGTCAGCGGTGAGGAA
CAGTGCCGGGACTTGTTTGATGAGGAAGACAAGGGCAAGATTGTCAGGGTGGAGAAGTGGGGGATGCAGAACAAG
GTGGTGCACTTCAAGACGCCTGAGGAACGAGACGCCGCCATGGCCCGACTGCCCGACGACGTCAAGACGCGAACC
CAAGAAGACCGGTCGAAGCCGCTGGTGAAGATCTTCCAGCACCGCGAGGGCAAGGCCTTCACCAACCGCGGTGGC
GCCGGCAACTGGGGAGGCAACGCTCGCGGAGGCAGCTCCGCGAGTGGTTATCGAAGCGCAGGGGGCACCAGCGAC
TCGGAAAGCAACCGCCGGGGCGGTCGCGGGGGTCGCGGGGGCCGCGGCGGCGACAGGAGCCGCGGAGGGCGAGGC
CGCGGAGGGATCAAGGGCGACACTGGCACTTCTTCTCCGGCAGCGCCGGCCACGCCGGCCGCCGAATGA
Gene >Hirsu2|3764
ATGGCTGCTGTGAGTTGCTCCCCCTTGGCCTCTTCTCTGCTGTCGCCCCCAAGCCCGTGCCTCGGGCAGCTGCAA
GGCATCGTCGCCTGCGTCTGCCTGCGGACCGTCAGCTTCGTCTTCCCCTGGCACGGCGACTCGGCCCTCCGTCTT
CCCTCAGCACCTCCTGCACGCCACTCCAGCCCCAGCATCGTCAACTCCATCGCTCTTCCTCGCCTGCGTGGCATG
CTTTTTGCATCCAAACCGCCCACAGATCCCCGCCCCTCCCGCCGTCATGGCATCGTCGCCTGCCCTCGACCGTCG
CCGTCCGCCCTGGAGCAAGTCGCAGGGCCCCCGCAGCGTCGCTGACTCTTCGCAGCCGCGACCGTACAACAATCC
AGGTTATCTCCAAAACGGCGCCACGGGGCTTCCCCAGCCTGGGGCAGCGCCTCTCCTGCCGAACCAAGGCCGCGT
GATCCAGACCGGCCCCATCAGAGTGCTCTGCATTGCAGATGTTCGCGGTTCGCAGTCCCCCCGCTCCTCTCTCCG
CCCGAGCTGACCCGAGAGTCGCTGACGCTGGGAGCCAGGAAACCTGAGATCGCTCAACGACCTGGCTAAGCAGGC
TCGCGCCGACCACATCATCCACACCGGCGACTTTGGCTTCTACGACGATACCTCGCTGGACCGAATCGTGGAGAA
AACACTCAAGCATGTGGCCCAATACTCGCCTCTCATCTCCGAACCCGTCAAGAAGGCAATCCAACAAGGGGGCAA
CGGCCCCGTCAAGAGTCGGTTTGCTCCCCAGGAGCTGCCCCTGTCGGAGCTGCCGCTCCTGCTCAGCGGAGAGCT
CAAGCTAGACGTGCCCGTCTACACCGTCTGGGGCGCGTGCGAGGACGTCCGTGTGTTGGAGAAATTCAGGTCCTC
CGAGTACAAGGTGCCCAATCTGCACATCATCGACGAGGCTCGCTCCATGCTCCTCGAAATCGGTGGCGTCAAGCT
CAGGCTGCTTGGCCTCGGCGGTGCCGTCGTCATGCACAAGCTTTTTGACAATGGCGAGGGCCGTACCACCATTGC
CGGTGGCCAGGGCACCATGTGGACTACTCTGCTGCAGATGGGAGAGCTTGTCGACACAGCCCATCGCGTTTACGA
CCCCACCGAGACCCGAATCTTCATCACACACGCATCGCCCGCGCGCGAGGGCATCCTGAACCAGCTTTCCGTCAC
GCTCAAGGCCGACTTCTCCATTTCGGCCGGTCTCCACTTCCGGTACGGCAGCTCCTACAACGAATTCAGCGTCAA
CCCAACGCTGGACCACTACCGCGGGAAGCTCGCCGCCTCCAAGGCCTCGTTCAACGACGTCTGGGAGACGGTCAA
GGGAGAGGTTGAGCCCGCCATTCAGCAGAACGAGGCCCAGCAGAATCTCCTCAAGAACGCGCTCCAGATTGTAGA
GAAGATGCCCACCACGGCGGCCGGCGGTAACCCGTTTGGTGGACCCGCTGCCGGTCAAGCTGCGCTCGGCCAGGT
GGATGAGAGCGCATTCAAGAACATGTGGAACTTCAACCTCGCCGACGCAGCCTTTGGCTATCTCGTTTTGGAGAT
TCAAGACGGTCGCATCGGCACCGAGATGCGCGCACAGGGCTTCAACTTCTCCCATCGCGGCGCAAAGCAACAGCC
CGGCGCGTCGACTGGCCCTCCGCCGGCATCCGCGGGCGGCCAACCTTCGCCCGCGACCACCTCTGCGCAGCTGGC
ACCCCCCCCGCAAACTAGCCGGCAGCCGTCCCAGCCGCCCAAAGCATCGGCTGCGACGCCGACGTCTGGCGGCAC
AAAACCGGGAACCCCCAAGCCGGGCCCGGGCACAGATAGCGCCGGCACCGCCAGCAAAGACCCCGAGAAGACGCC
CGCGGCGGCAAACGGATCCGCCAACGGCCCCGAGCTTACCGCATCGCCTGCCCCCAAGTCTCTTGCCTCGGACAT
CATCGGCCTGTTCATCATGAACGTCAGCGGTGAGGAACAGTGCCGGGACTTGTTTGATGAGGAAGACAAGGGCAA
GATTGTCAGGGTGGAGAAGTGGGGGATGCAGAACAAGGTGGTGCACTTCAAGACGCCTGAGGAACGAGACGCCGC
CATGGCCCGACTGCCCGACGACGTCAAGACGCGAACCCAAGAAGACCGGTCGAAGCCGCTGGTGAAGATCTTCCA
GCACCGCGAGGGCAAGGCCTTCACCAACCGCGGTGGCGCCGGCAACTGGGGAGGCAACGCTCGCGGAGGCAGCTC
CGCGAGTGGTTATCGAAGCGCAGGGGGCACCAGCGACTCGGAAAGCAACCGCCGGGGCGGTCGCGGGGGTCGCGG
GGGCCGCGGCGGCGACAGGAGCCGCGGAGGGCGAGGCCGCGGAGGGATCAAGGGCGACACTGGCACTTCTTCTCC
GGCAGCGCCGGCCACGCCGGCCGCCGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail