Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3756
Gene name
LocationContig_20:54267..56643
Strand-
Gene length (bp)2376
Transcript length (bp)2376
Coding sequence length (bp)2376
Protein length (aa) 792

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00382 TFIIB Transcription factor TFIIB repeat 1.3E-08 149 211
PF00382 TFIIB Transcription factor TFIIB repeat 2.7E-19 244 317
PF07741 BRF1 Brf1-like TBP-binding domain 3.6E-24 586 685

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6R0|TF3B_SCHPO Transcription factor IIIB 60 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brf1 PE=1 SV=2 79 354 5.0E-68
sp|Q8CFK2|TF3B_MOUSE Transcription factor IIIB 90 kDa subunit OS=Mus musculus GN=Brf1 PE=1 SV=1 76 371 9.0E-63
sp|P29056|TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRF1 PE=1 SV=1 76 361 2.0E-61
sp|Q92994|TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens GN=BRF1 PE=1 SV=1 76 371 8.0E-61
sp|P43072|TF3B_CANAL Transcription factor IIIB 70 kDa subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TDS4 PE=3 SV=1 76 352 2.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6R0|TF3B_SCHPO Transcription factor IIIB 60 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brf1 PE=1 SV=2 79 354 5.0E-68
sp|Q8CFK2|TF3B_MOUSE Transcription factor IIIB 90 kDa subunit OS=Mus musculus GN=Brf1 PE=1 SV=1 76 371 9.0E-63
sp|P29056|TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRF1 PE=1 SV=1 76 361 2.0E-61
sp|Q92994|TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens GN=BRF1 PE=1 SV=1 76 371 8.0E-61
sp|P43072|TF3B_CANAL Transcription factor IIIB 70 kDa subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TDS4 PE=3 SV=1 76 352 2.0E-59
sp|P46070|TF3B_KLULA Transcription factor IIIB 70 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TDS4 PE=3 SV=2 79 337 2.0E-58
sp|Q9HJM7|TF2B1_THEAC Transcription initiation factor IIB 1 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tfbA PE=3 SV=1 127 335 7.0E-16
sp|Q979Q3|TF2B1_THEVO Transcription initiation factor IIB 1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tfbA PE=3 SV=1 127 335 4.0E-15
sp|O28970|TF2B_ARCFU Transcription initiation factor IIB OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tfb PE=3 SV=1 127 338 3.0E-14
sp|Q2NEL6|TF2B_METST Transcription initiation factor IIB OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tfb PE=3 SV=1 150 334 4.0E-14
sp|Q9Y942|TF2B_AERPE Transcription initiation factor IIB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tfb PE=3 SV=2 136 324 6.0E-13
sp|A5UKA1|TF2B_METS3 Transcription initiation factor IIB OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tfb PE=3 SV=1 150 334 1.0E-12
sp|O26971|TF2B_METTH Transcription initiation factor IIB OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tfb PE=3 SV=1 150 325 1.0E-12
sp|Q9HHK5|TF2B3_HALSA Transcription initiation factor IIB 3 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbC PE=3 SV=1 136 323 2.0E-12
sp|P50387|TF2B_SULSH Transcription initiation factor IIB OS=Sulfolobus shibatae GN=tfb PE=3 SV=1 128 334 2.0E-12
sp|P58111|TF2B1_SULSO Transcription initiation factor IIB 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tfbA PE=3 SV=1 128 334 4.0E-12
sp|Q5JGN1|TF2B1_THEKO Transcription initiation factor IIB 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tfb1 PE=3 SV=1 128 324 7.0E-12
sp|O59151|TF2B_PYRHO Transcription initiation factor IIB OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tfb PE=3 SV=1 152 324 8.0E-12
sp|P61999|TF2B_PYRWO Transcription initiation factor IIB OS=Pyrococcus woesei GN=tfb PE=1 SV=1 152 334 9.0E-12
sp|P61998|TF2B_PYRFU Transcription initiation factor IIB OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tfb PE=1 SV=1 152 334 9.0E-12
sp|Q9V0V5|TF2B_PYRAB Transcription initiation factor IIB OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tfb PE=3 SV=1 152 324 2.0E-11
sp|A6UW60|TF2B_META3 Transcription initiation factor IIB OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tfb PE=3 SV=1 31 325 3.0E-11
sp|Q9HSF7|TF2B7_HALSA Transcription initiation factor IIB 7 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbG PE=3 SV=1 150 323 1.0E-10
sp|Q9P9I7|TF2B_METTL Transcription initiation factor IIB OS=Methanothermococcus thermolithotrophicus GN=tfb PE=3 SV=1 127 325 2.0E-10
sp|Q58192|TF2B_METJA Transcription initiation factor IIB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tfb PE=3 SV=1 127 325 2.0E-10
sp|Q8TX21|TF2B_METKA Transcription initiation factor IIB OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tfb PE=3 SV=1 128 324 2.0E-10
sp|A6VI28|TF2B_METM7 Transcription initiation factor IIB OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tfb PE=3 SV=1 127 325 3.0E-10
sp|A9A8Q0|TF2B_METM6 Transcription initiation factor IIB OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tfb PE=3 SV=1 127 325 3.0E-10
sp|Q6M176|TF2B_METMP Transcription initiation factor IIB OS=Methanococcus maripaludis (strain S2 / LL) GN=tfb PE=3 SV=1 127 325 5.0E-10
sp|A4G0F2|TF2B_METM5 Transcription initiation factor IIB OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tfb PE=3 SV=1 127 325 2.0E-09
sp|B8GJQ9|TF2B_METPE Transcription initiation factor IIB OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tfb PE=3 SV=1 127 338 4.0E-09
sp|A3CSQ6|TF2B_METMJ Transcription initiation factor IIB OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tfb PE=3 SV=1 127 338 5.0E-09
sp|Q979P7|TF2B2_THEVO Transcription initiation factor IIB 2 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tfbB PE=3 SV=1 127 325 5.0E-09
sp|A7IAR4|TF2B_METB6 Transcription initiation factor IIB OS=Methanoregula boonei (strain 6A8) GN=tfb PE=3 SV=1 127 338 5.0E-09
sp|A8AC96|TF2B_IGNH4 Transcription initiation factor IIB OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tfb PE=3 SV=1 128 324 6.0E-09
sp|Q9HJM2|TF2B2_THEAC Transcription initiation factor IIB 2 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tfbB PE=3 SV=1 127 325 1.0E-08
sp|Q9HRE6|TF2B2_HALSA Transcription initiation factor IIB 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbB PE=3 SV=1 135 324 2.0E-08
sp|Q8SRP3|TF2B_ENCCU Transcription initiation factor IIB OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_1100i PE=3 SV=1 136 324 5.0E-08
sp|A0B5T8|TF2B_METTP Transcription initiation factor IIB OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tfb PE=3 SV=1 127 324 8.0E-08
sp|Q975S1|TF2B_SULTO Transcription initiation factor IIB OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tfb PE=3 SV=1 128 325 2.0E-07
sp|A8MCX6|TF2B_CALMQ Transcription initiation factor IIB OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tfb PE=3 SV=1 127 324 3.0E-07
sp|P29052|TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster GN=TfIIB PE=2 SV=1 127 337 7.0E-07
sp|P0CW14|TF2B_METMZ Transcription initiation factor IIB OS=Methanosarcina mazei GN=tfb PE=3 SV=1 110 324 9.0E-07
sp|P0CW15|TF2B_METMA Transcription initiation factor IIB OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tfb PE=3 SV=1 110 324 9.0E-07
sp|Q8TT29|TF2B_METAC Transcription initiation factor IIB OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tfb PE=3 SV=1 110 324 9.0E-07
sp|Q9HHH8|TF2B5_HALSA Transcription initiation factor IIB 5 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbE PE=3 SV=1 132 319 1.0E-06
sp|Q9UWN6|TF2B_SULAC Transcription initiation factor IIB OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tfb PE=3 SV=2 128 325 2.0E-06
sp|Q9HNA2|TF2B1_HALSA Transcription initiation factor IIB 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbA PE=3 SV=1 153 325 2.0E-06
sp|Q54FD6|TF2B_DICDI Transcription initiation factor IIB OS=Dictyostelium discoideum GN=gtf2b PE=3 SV=1 150 324 2.0E-06
sp|Q9NHP7|TF2B_DROVI Transcription initiation factor IIB OS=Drosophila virilis GN=TfIIB PE=3 SV=1 127 337 4.0E-06
sp|Q9HSB3|TF2B6_HALSA Transcription initiation factor IIB 6 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbF PE=3 SV=1 135 324 6.0E-06
sp|Q9HR45|TF2B4_HALSA Transcription initiation factor IIB 4 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tfbD PE=3 SV=1 135 324 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0017025 TBP-class protein binding Yes
GO:0005515 protein binding No
GO:0140296 general transcription initiation factor binding No
GO:0003674 molecular_function No
GO:0008134 transcription factor binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3756
MSSSLNPTRRGGLLKPRFARPNPIRAMREREERRQAASASQQSHASSASANRSGSVAVPARQQCLNKACPKPNVV
DGTCQTCGRVADDSNIVAEVQFGETSSGAAMVQGSFVAADQAGVRSMGPAFRRVGGSEDREKSIREARGLMQGYA
QQLNISESLVTSGTQVFKLASGANFVQGRTLASVAAVCLYAACRAEPPCKVMLIDLADLVQLNVFKLGRIFKKLN
EVVPIGNDGLIPVYPEDLIWRFATKMEFHQDTAKVAEDAVRLVKRMSRDWMVMGRRPSGICGACLLMAARMHNFR
RTVREVVYIVKVTNHTIQNRLQEFNVTESSKMSVEDFLKQDFLESSHDPPSFYRKSDEYRKKRMRGKLRKRKRKA
AAKDKDHDVDDDDDDGDDDVDGDGKDDDLEGEIDGDHDGDGHHLSSERQAVENAAKGQRRLTEGGADLSKAPAVE
FRRDADGFIIPLLPSQIPADRPDNADNADGGEDNLERLANEFGDTIDEELDKDAGESSRKGRRRPPKPQLPINEE
WEQDEEELEGQIEEIFNDPLTYEHALAYSNAEQRARIHTNWALRQKPQKDVSMAADIGEDEFADDPEVLNCLLSP
EEARIKELIWVNQNKDWLRQHQEKVFRRKVEAERPKQTRRRRKRARMGEGQTSPASSAAEAAINVAKDRAWSKRI
NYDAIRSIFDVPIAGGLGSAATSRKTSVAGSIMGGADDDNEEAEESVAGGGEGGGKQQAEQEQEDEDDAAEHDFD
ETQDFDETQDFGGGGGEFEGGYEDDDNPDLDAEYGLDDYEE*
Coding >Hirsu2|3756
ATGTCTTCGTCGCTAAATCCTACCCGGCGAGGCGGCCTTCTGAAGCCGCGCTTCGCCAGGCCGAACCCCATCCGA
GCGATGCGTGAGCGCGAAGAACGCCGCCAGGCCGCCTCTGCCTCGCAGCAGTCGCACGCCTCGTCGGCCTCGGCC
AACCGCAGCGGCTCCGTCGCCGTGCCCGCCCGCCAGCAGTGCCTCAACAAGGCCTGTCCCAAGCCCAACGTCGTC
GACGGCACCTGCCAGACCTGTGGCCGTGTGGCCGATGACAGCAACATCGTCGCAGAGGTCCAGTTCGGCGAGACG
TCGTCCGGCGCGGCCATGGTCCAGGGCTCCTTCGTCGCCGCCGACCAGGCCGGCGTCCGCAGCATGGGCCCTGCC
TTCAGGAGGGTCGGCGGTTCCGAAGACCGCGAGAAGAGCATCCGCGAGGCTCGCGGCCTCATGCAGGGCTACGCC
CAGCAGCTCAACATCAGCGAGAGCCTCGTCACCTCGGGCACCCAGGTCTTCAAGCTCGCCTCGGGCGCAAACTTC
GTCCAGGGCCGCACCCTCGCCAGCGTCGCCGCCGTCTGCCTCTACGCCGCCTGCCGCGCCGAGCCGCCCTGCAAG
GTCATGCTCATCGACTTGGCCGACCTGGTCCAGCTCAACGTCTTCAAGCTCGGCCGCATCTTCAAGAAGCTCAAC
GAGGTGGTGCCCATCGGCAACGACGGCCTGATCCCAGTCTACCCCGAGGACCTCATCTGGCGCTTTGCCACCAAG
ATGGAGTTCCACCAAGACACGGCCAAGGTGGCCGAGGACGCCGTCCGACTCGTCAAGCGCATGAGCCGAGACTGG
ATGGTTATGGGCCGTCGCCCCTCGGGAATTTGCGGCGCCTGCCTGCTCATGGCCGCGCGCATGCACAACTTCCGC
CGCACCGTCCGGGAAGTCGTCTACATCGTCAAGGTCACCAACCACACCATCCAGAACCGCTTGCAGGAGTTCAAC
GTGACCGAGTCGAGCAAAATGTCCGTCGAGGACTTCCTCAAGCAGGACTTCCTCGAGAGCTCACACGACCCGCCC
TCCTTCTACCGCAAGTCCGACGAGTACAGGAAGAAAAGGATGCGGGGCAAGTTGCGCAAGCGGAAGCGCAAGGCA
GCCGCCAAGGACAAGGATCACGACGTCGACGACGATGACGACGACGGTGACGACGATGTCGACGGTGACGGAAAG
GACGACGACTTGGAGGGGGAGATTGATGGCGACCATGACGGAGACGGGCACCATCTGTCGTCGGAGCGTCAGGCC
GTCGAGAATGCGGCCAAAGGCCAGCGGCGGCTGACCGAAGGCGGCGCCGACCTGTCCAAGGCCCCCGCCGTCGAG
TTTCGACGCGACGCCGACGGCTTCATCATTCCGCTCCTGCCCTCTCAAATCCCTGCCGACCGCCCCGACAATGCC
GACAACGCCGATGGCGGCGAGGACAATTTGGAGCGACTGGCAAATGAGTTTGGCGACACCATCGACGAAGAGCTG
GACAAGGACGCCGGCGAATCCTCTAGGAAGGGCCGGCGCCGGCCTCCCAAGCCCCAACTTCCCATCAACGAAGAG
TGGGAGCAGGACGAGGAGGAGCTCGAGGGGCAAATCGAGGAAATATTCAACGACCCCCTCACATACGAGCACGCC
CTCGCCTACTCAAACGCTGAGCAGCGGGCCAGGATCCATACCAACTGGGCGCTGCGTCAGAAGCCGCAGAAGGAC
GTGTCGATGGCGGCCGACATCGGCGAGGACGAGTTTGCCGACGACCCCGAGGTGCTCAACTGCCTGCTGTCGCCG
GAGGAGGCGCGCATCAAGGAGCTGATCTGGGTCAACCAGAACAAGGACTGGCTGCGGCAACACCAGGAAAAGGTC
TTTCGGAGGAAGGTCGAGGCAGAGCGGCCAAAGCAGACGCGTCGCAGGCGGAAGCGGGCGCGAATGGGCGAGGGC
CAGACCAGCCCGGCCAGCTCGGCAGCCGAGGCGGCCATCAACGTGGCGAAGGACAGGGCATGGTCCAAGAGGATC
AACTACGATGCCATCCGCAGCATCTTCGACGTCCCCATCGCCGGCGGTCTGGGCTCGGCGGCCACGAGCCGCAAG
ACGAGCGTTGCGGGCAGCATCATGGGCGGCGCCGACGACGACAATGAGGAGGCCGAGGAGAGCGTTGCAGGGGGC
GGCGAAGGAGGGGGGAAGCAGCAGGCAGAGCAGGAGCAGGAGGACGAGGACGATGCGGCGGAGCATGACTTTGAC
GAGACACAAGACTTTGACGAGACGCAGGACTTTGGCGGAGGAGGAGGTGAGTTCGAGGGCGGGTACGAGGACGAC
GACAACCCCGACCTCGACGCCGAGTACGGACTCGACGACTATGAGGAGTGA
Transcript >Hirsu2|3756
ATGTCTTCGTCGCTAAATCCTACCCGGCGAGGCGGCCTTCTGAAGCCGCGCTTCGCCAGGCCGAACCCCATCCGA
GCGATGCGTGAGCGCGAAGAACGCCGCCAGGCCGCCTCTGCCTCGCAGCAGTCGCACGCCTCGTCGGCCTCGGCC
AACCGCAGCGGCTCCGTCGCCGTGCCCGCCCGCCAGCAGTGCCTCAACAAGGCCTGTCCCAAGCCCAACGTCGTC
GACGGCACCTGCCAGACCTGTGGCCGTGTGGCCGATGACAGCAACATCGTCGCAGAGGTCCAGTTCGGCGAGACG
TCGTCCGGCGCGGCCATGGTCCAGGGCTCCTTCGTCGCCGCCGACCAGGCCGGCGTCCGCAGCATGGGCCCTGCC
TTCAGGAGGGTCGGCGGTTCCGAAGACCGCGAGAAGAGCATCCGCGAGGCTCGCGGCCTCATGCAGGGCTACGCC
CAGCAGCTCAACATCAGCGAGAGCCTCGTCACCTCGGGCACCCAGGTCTTCAAGCTCGCCTCGGGCGCAAACTTC
GTCCAGGGCCGCACCCTCGCCAGCGTCGCCGCCGTCTGCCTCTACGCCGCCTGCCGCGCCGAGCCGCCCTGCAAG
GTCATGCTCATCGACTTGGCCGACCTGGTCCAGCTCAACGTCTTCAAGCTCGGCCGCATCTTCAAGAAGCTCAAC
GAGGTGGTGCCCATCGGCAACGACGGCCTGATCCCAGTCTACCCCGAGGACCTCATCTGGCGCTTTGCCACCAAG
ATGGAGTTCCACCAAGACACGGCCAAGGTGGCCGAGGACGCCGTCCGACTCGTCAAGCGCATGAGCCGAGACTGG
ATGGTTATGGGCCGTCGCCCCTCGGGAATTTGCGGCGCCTGCCTGCTCATGGCCGCGCGCATGCACAACTTCCGC
CGCACCGTCCGGGAAGTCGTCTACATCGTCAAGGTCACCAACCACACCATCCAGAACCGCTTGCAGGAGTTCAAC
GTGACCGAGTCGAGCAAAATGTCCGTCGAGGACTTCCTCAAGCAGGACTTCCTCGAGAGCTCACACGACCCGCCC
TCCTTCTACCGCAAGTCCGACGAGTACAGGAAGAAAAGGATGCGGGGCAAGTTGCGCAAGCGGAAGCGCAAGGCA
GCCGCCAAGGACAAGGATCACGACGTCGACGACGATGACGACGACGGTGACGACGATGTCGACGGTGACGGAAAG
GACGACGACTTGGAGGGGGAGATTGATGGCGACCATGACGGAGACGGGCACCATCTGTCGTCGGAGCGTCAGGCC
GTCGAGAATGCGGCCAAAGGCCAGCGGCGGCTGACCGAAGGCGGCGCCGACCTGTCCAAGGCCCCCGCCGTCGAG
TTTCGACGCGACGCCGACGGCTTCATCATTCCGCTCCTGCCCTCTCAAATCCCTGCCGACCGCCCCGACAATGCC
GACAACGCCGATGGCGGCGAGGACAATTTGGAGCGACTGGCAAATGAGTTTGGCGACACCATCGACGAAGAGCTG
GACAAGGACGCCGGCGAATCCTCTAGGAAGGGCCGGCGCCGGCCTCCCAAGCCCCAACTTCCCATCAACGAAGAG
TGGGAGCAGGACGAGGAGGAGCTCGAGGGGCAAATCGAGGAAATATTCAACGACCCCCTCACATACGAGCACGCC
CTCGCCTACTCAAACGCTGAGCAGCGGGCCAGGATCCATACCAACTGGGCGCTGCGTCAGAAGCCGCAGAAGGAC
GTGTCGATGGCGGCCGACATCGGCGAGGACGAGTTTGCCGACGACCCCGAGGTGCTCAACTGCCTGCTGTCGCCG
GAGGAGGCGCGCATCAAGGAGCTGATCTGGGTCAACCAGAACAAGGACTGGCTGCGGCAACACCAGGAAAAGGTC
TTTCGGAGGAAGGTCGAGGCAGAGCGGCCAAAGCAGACGCGTCGCAGGCGGAAGCGGGCGCGAATGGGCGAGGGC
CAGACCAGCCCGGCCAGCTCGGCAGCCGAGGCGGCCATCAACGTGGCGAAGGACAGGGCATGGTCCAAGAGGATC
AACTACGATGCCATCCGCAGCATCTTCGACGTCCCCATCGCCGGCGGTCTGGGCTCGGCGGCCACGAGCCGCAAG
ACGAGCGTTGCGGGCAGCATCATGGGCGGCGCCGACGACGACAATGAGGAGGCCGAGGAGAGCGTTGCAGGGGGC
GGCGAAGGAGGGGGGAAGCAGCAGGCAGAGCAGGAGCAGGAGGACGAGGACGATGCGGCGGAGCATGACTTTGAC
GAGACACAAGACTTTGACGAGACGCAGGACTTTGGCGGAGGAGGAGGTGAGTTCGAGGGCGGGTACGAGGACGAC
GACAACCCCGACCTCGACGCCGAGTACGGACTCGACGACTATGAGGAGTGA
Gene >Hirsu2|3756
ATGTCTTCGTCGCTAAATCCTACCCGGCGAGGCGGCCTTCTGAAGCCGCGCTTCGCCAGGCCGAACCCCATCCGA
GCGATGCGTGAGCGCGAAGAACGCCGCCAGGCCGCCTCTGCCTCGCAGCAGTCGCACGCCTCGTCGGCCTCGGCC
AACCGCAGCGGCTCCGTCGCCGTGCCCGCCCGCCAGCAGTGCCTCAACAAGGCCTGTCCCAAGCCCAACGTCGTC
GACGGCACCTGCCAGACCTGTGGCCGTGTGGCCGATGACAGCAACATCGTCGCAGAGGTCCAGTTCGGCGAGACG
TCGTCCGGCGCGGCCATGGTCCAGGGCTCCTTCGTCGCCGCCGACCAGGCCGGCGTCCGCAGCATGGGCCCTGCC
TTCAGGAGGGTCGGCGGTTCCGAAGACCGCGAGAAGAGCATCCGCGAGGCTCGCGGCCTCATGCAGGGCTACGCC
CAGCAGCTCAACATCAGCGAGAGCCTCGTCACCTCGGGCACCCAGGTCTTCAAGCTCGCCTCGGGCGCAAACTTC
GTCCAGGGCCGCACCCTCGCCAGCGTCGCCGCCGTCTGCCTCTACGCCGCCTGCCGCGCCGAGCCGCCCTGCAAG
GTCATGCTCATCGACTTGGCCGACCTGGTCCAGCTCAACGTCTTCAAGCTCGGCCGCATCTTCAAGAAGCTCAAC
GAGGTGGTGCCCATCGGCAACGACGGCCTGATCCCAGTCTACCCCGAGGACCTCATCTGGCGCTTTGCCACCAAG
ATGGAGTTCCACCAAGACACGGCCAAGGTGGCCGAGGACGCCGTCCGACTCGTCAAGCGCATGAGCCGAGACTGG
ATGGTTATGGGCCGTCGCCCCTCGGGAATTTGCGGCGCCTGCCTGCTCATGGCCGCGCGCATGCACAACTTCCGC
CGCACCGTCCGGGAAGTCGTCTACATCGTCAAGGTCACCAACCACACCATCCAGAACCGCTTGCAGGAGTTCAAC
GTGACCGAGTCGAGCAAAATGTCCGTCGAGGACTTCCTCAAGCAGGACTTCCTCGAGAGCTCACACGACCCGCCC
TCCTTCTACCGCAAGTCCGACGAGTACAGGAAGAAAAGGATGCGGGGCAAGTTGCGCAAGCGGAAGCGCAAGGCA
GCCGCCAAGGACAAGGATCACGACGTCGACGACGATGACGACGACGGTGACGACGATGTCGACGGTGACGGAAAG
GACGACGACTTGGAGGGGGAGATTGATGGCGACCATGACGGAGACGGGCACCATCTGTCGTCGGAGCGTCAGGCC
GTCGAGAATGCGGCCAAAGGCCAGCGGCGGCTGACCGAAGGCGGCGCCGACCTGTCCAAGGCCCCCGCCGTCGAG
TTTCGACGCGACGCCGACGGCTTCATCATTCCGCTCCTGCCCTCTCAAATCCCTGCCGACCGCCCCGACAATGCC
GACAACGCCGATGGCGGCGAGGACAATTTGGAGCGACTGGCAAATGAGTTTGGCGACACCATCGACGAAGAGCTG
GACAAGGACGCCGGCGAATCCTCTAGGAAGGGCCGGCGCCGGCCTCCCAAGCCCCAACTTCCCATCAACGAAGAG
TGGGAGCAGGACGAGGAGGAGCTCGAGGGGCAAATCGAGGAAATATTCAACGACCCCCTCACATACGAGCACGCC
CTCGCCTACTCAAACGCTGAGCAGCGGGCCAGGATCCATACCAACTGGGCGCTGCGTCAGAAGCCGCAGAAGGAC
GTGTCGATGGCGGCCGACATCGGCGAGGACGAGTTTGCCGACGACCCCGAGGTGCTCAACTGCCTGCTGTCGCCG
GAGGAGGCGCGCATCAAGGAGCTGATCTGGGTCAACCAGAACAAGGACTGGCTGCGGCAACACCAGGAAAAGGTC
TTTCGGAGGAAGGTCGAGGCAGAGCGGCCAAAGCAGACGCGTCGCAGGCGGAAGCGGGCGCGAATGGGCGAGGGC
CAGACCAGCCCGGCCAGCTCGGCAGCCGAGGCGGCCATCAACGTGGCGAAGGACAGGGCATGGTCCAAGAGGATC
AACTACGATGCCATCCGCAGCATCTTCGACGTCCCCATCGCCGGCGGTCTGGGCTCGGCGGCCACGAGCCGCAAG
ACGAGCGTTGCGGGCAGCATCATGGGCGGCGCCGACGACGACAATGAGGAGGCCGAGGAGAGCGTTGCAGGGGGC
GGCGAAGGAGGGGGGAAGCAGCAGGCAGAGCAGGAGCAGGAGGACGAGGACGATGCGGCGGAGCATGACTTTGAC
GAGACACAAGACTTTGACGAGACGCAGGACTTTGGCGGAGGAGGAGGTGAGTTCGAGGGCGGGTACGAGGACGAC
GACAACCCCGACCTCGACGCCGAGTACGGACTCGACGACTATGAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail