Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3754
Gene name
LocationContig_20:51091..52420
Strand-
Gene length (bp)1329
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum|Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1293 0.1295 0.0728 0.2194 0.1168 0.0121 0.8772 0.6204 0.5781 0.0116

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 41 60 19
2 80 102 22
3 136 158 22
4 210 232 22
5 239 261 22
6 284 306 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2539
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|891
Ophiocordyceps australis map64 (Brazil) OphauB2|3483
Ophiocordyceps camponoti-floridani Ophcf2|04569
Ophiocordyceps camponoti-rufipedis Ophun1|2503
Ophiocordyceps kimflemingae Ophio5|7151
Ophiocordyceps subramaniannii Hirsu2|3754 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3754
MSSTPLLSAAGGLPGPNVMQDHPAFLRVSHSPWGFIPQNVLVALRGIVLAYLTATAFMIGHHKLTEESEVGQIRH
LFDFGLISYGMVTLYHLMTFCWTFTHLYYPDADAIRGGVESLLVRAMSLPSNMGSLRKQFYFTLFYAVTTVFSFM
NTAIYWSVTRPHEGGGAGEALLMAAAASDVPTGLGEVASSSTMTTIEGPFSDLFGEGWFTVFVLCNLYGVTSGFM
VFETLFLNSTKRPIAIGSHFFGVMFHAGLYLAWAAAGKALTDAFPFFWLDEAEVGSKEAVTAYCMGFVLLSPIMY
TLMLGFVGIREGLTRPGSEQAVGEAREDVDN*
Coding >Hirsu2|3754
ATGTCGTCGACGCCTCTTCTCTCCGCTGCCGGCGGCCTTCCTGGGCCCAATGTGATGCAGGACCATCCTGCCTTT
CTCCGAGTCAGCCATTCGCCATGGGGATTCATCCCCCAGAATGTCCTCGTCGCTCTGCGAGGCATCGTCTTGGCC
TACCTGACGGCCACGGCTTTCATGATTGGCCACCACAAGCTCACCGAGGAGTCGGAGGTGGGCCAGATCCGGCAC
CTTTTTGACTTCGGCCTGATCAGCTACGGCATGGTGACGCTGTATCACCTCATGACCTTTTGTTGGACCTTTACG
CACCTGTACTACCCCGATGCCGACGCCATCCGAGGCGGTGTTGAGTCGCTGCTGGTCCGCGCCATGTCTCTTCCC
AGCAACATGGGCAGCCTACGCAAGCAGTTCTACTTCACCTTGTTCTACGCAGTCACCACTGTCTTCTCCTTCATG
AACACGGCCATCTACTGGTCGGTAACCCGCCCGCATGAGGGAGGCGGCGCCGGTGAGGCACTCTTGATGGCGGCT
GCGGCAAGCGACGTGCCGACTGGGCTGGGCGAGGTTGCGAGCAGCTCGACCATGACTACGATTGAGGGGCCTTTC
AGCGATCTCTTCGGCGAGGGATGGTTCACCGTCTTCGTCCTTTGCAACCTGTACGGAGTCACGTCGGGCTTCATG
GTCTTCGAGACGCTGTTCCTCAATAGCACCAAGCGGCCCATTGCCATCGGATCGCACTTCTTTGGCGTCATGTTC
CATGCGGGCCTCTACCTCGCTTGGGCCGCGGCAGGAAAGGCCCTGACGGACGCGTTTCCCTTCTTCTGGCTTGAC
GAGGCCGAGGTTGGCTCCAAGGAGGCCGTGACCGCCTACTGCATGGGCTTCGTGCTCCTGTCGCCGATCATGTAC
ACGCTGATGCTCGGCTTCGTGGGCATCCGCGAGGGCTTGACGCGCCCCGGGTCGGAGCAAGCCGTCGGCGAGGCA
CGTGAAGACGTGGACAATTGA
Transcript >Hirsu2|3754
ATGTCGTCGACGCCTCTTCTCTCCGCTGCCGGCGGCCTTCCTGGGCCCAATGTGATGCAGGACCATCCTGCCTTT
CTCCGAGTCAGCCATTCGCCATGGGGATTCATCCCCCAGAATGTCCTCGTCGCTCTGCGAGGCATCGTCTTGGCC
TACCTGACGGCCACGGCTTTCATGATTGGCCACCACAAGCTCACCGAGGAGTCGGAGGTGGGCCAGATCCGGCAC
CTTTTTGACTTCGGCCTGATCAGCTACGGCATGGTGACGCTGTATCACCTCATGACCTTTTGTTGGACCTTTACG
CACCTGTACTACCCCGATGCCGACGCCATCCGAGGCGGTGTTGAGTCGCTGCTGGTCCGCGCCATGTCTCTTCCC
AGCAACATGGGCAGCCTACGCAAGCAGTTCTACTTCACCTTGTTCTACGCAGTCACCACTGTCTTCTCCTTCATG
AACACGGCCATCTACTGGTCGGTAACCCGCCCGCATGAGGGAGGCGGCGCCGGTGAGGCACTCTTGATGGCGGCT
GCGGCAAGCGACGTGCCGACTGGGCTGGGCGAGGTTGCGAGCAGCTCGACCATGACTACGATTGAGGGGCCTTTC
AGCGATCTCTTCGGCGAGGGATGGTTCACCGTCTTCGTCCTTTGCAACCTGTACGGAGTCACGTCGGGCTTCATG
GTCTTCGAGACGCTGTTCCTCAATAGCACCAAGCGGCCCATTGCCATCGGATCGCACTTCTTTGGCGTCATGTTC
CATGCGGGCCTCTACCTCGCTTGGGCCGCGGCAGGAAAGGCCCTGACGGACGCGTTTCCCTTCTTCTGGCTTGAC
GAGGCCGAGGTTGGCTCCAAGGAGGCCGTGACCGCCTACTGCATGGGCTTCGTGCTCCTGTCGCCGATCATGTAC
ACGCTGATGCTCGGCTTCGTGGGCATCCGCGAGGGCTTGACGCGCCCCGGGTCGGAGCAAGCCGTCGGCGAGGCA
CGTGAAGACGTGGACAATTGA
Gene >Hirsu2|3754
ATGTCGTCGACGCCTCTTCTCTCCGCTGCCGGCGGCCTTCCTGGGCCCAATGTGATGCAGGACCATGTGAGTGGC
CCTGTGACTCGCCTCTCTCTGCCACTGCTGACTTGTGACGCTCTTGATAGCCTGCCTTTCTCCGAGTCAGCCATT
CGCCATGGGGATTCATCCCCCAGAATGTCCTCGTCGCTCTGCGAGGCATCGTCTTGGCCTACCTGACGGCCACGG
CTTTCATGATTGGCCACCACAAGCTCACCGAGGAGTCGGAGGTGGGCCAGATCCGGCACCTTTTTGACTTCGGCC
TGATCAGCTACGGCATGGTGACGCTGTATCACCTCATGACCTTTGTAAGTCACCCCGGCCCCCCCTCGACCCGGT
GCCCTGGCGACGATGGGACGCTGACGAGAAGCAGTGTTGGACCTTTACGCACCTGTACTACCCCGATGCCGACGC
CATCCGAGGCGGTGTTGAGTCGCTGCTGGTCCGCGCCATGTCTCTTCCCAGCAACATGGGCAGCCTACGCAAGCA
GTTCTACTTCACCTTGTTCTACGCAGTCACCACTGTCTTCTCCTTCATGAACACGGCCATCTACTGGTCGGTAAC
CCGCCCGCATGAGGGAGGCGGCGCCGGTGAGGCACTCTTGATGGCGGCTGCGGCAAGCGACGTGCCGACTGGGCT
GGGCGAGGTTGCGAGCAGCTCGACCATGACTACGATTGAGGGGCCTTGTAAGTCTGCTACTACTCTTGCCCCTTG
TCTGCTGTCACATGGTTTACGGCGCTGACGGGGACATGTAGTCAGCGATCTCTTCGGCGAGGGATGGTTCACCGT
CTTCGTCCTTTGCAACCTGTACGGAGTCACGTCGGGCTTCATGGTCTTCGAGACGCTGTTCCTCAATAGCACCAA
GCGGCCCATTGTGAGATTCCCCGCGGCGCCTGTCCCGCTCTTCCGGCCAGGGCGTGGCGCAGTGACTGACGGTTG
AACCCCTAGGCCATCGGATCGCACTTCTTTGGCGTCATGTTCCATGCGGGCCTCTACCTCGCTTGGGCCGCGGCA
GGAAAGGCCCTGACGGACGCGTTTCCCTTCTTCTGGCTTGACGAGGCCGAGGTTGGCTCCAAGGAGGCCGTGACC
GCCTACTGCATGGGCTTCGTGCTCCTGTCGCCGATCAGTGAGTTTGACTTGGACGAGGCGTGAGAACGTGATGGT
GACGCAGCTAACGCTTGACGGCGCGCAGTGTACACGCTGATGCTCGGCTTCGTGGGCATCCGCGAGGGCTTGACG
CGCCCCGGGTCGGAGCAAGCCGTCGGCGAGGCACGTGAAGACGTGGACAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail