Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3749
Gene name
LocationContig_20:38303..39282
Strand+
Gene length (bp)979
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 4.5E-08 121 242
PF08241 Methyltransf_11 Methyltransferase domain 1.1E-07 124 223
PF13649 Methyltransf_25 Methyltransferase domain 2.3E-07 123 206

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 54 298 1.0E-66
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 54 298 4.0E-66
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3 308 3.0E-40

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3749
MDQKVASLLRSHEFIEDVAVQWQDDDMTAFVTLRKLAIEYYQGLAGMGDGFASQQVELWETVFDAAVYPTIENNM
RPEEIGRDFHGWISAYDGSLLGNTAMNEWLDDIIETILCCNGQRLLDVLELGTGSGMMLFNLAKRLRSYIGIELT
QAAVEFVTAITKSMPELASKVLVRHGTATDLHLFASCSPDLVIINSVAQYFPSRDYLLKVVENTLALKGVLIIVF
GDVRSYALEEEFFVSKALCKLGGNASKEQVRQKVVEMSRAELELLIDPAFFTSLQDRFPQLIEHVEILPKKMKEP
GLGRRSTT*
Coding >Hirsu2|3749
ATGGATCAAAAAGTCGCAAGCCTACTCCGCAGCCATGAATTCATCGAGGATGTCGCTGTGCAGTGGCAAGATGAT
GACATGACCGCTTTTGTCACCCTACGCAAGCTTGCGATTGAGTATTACCAAGGCCTTGCGGGCATGGGCGATGGA
TTCGCGTCTCAGCAGGTAGAGCTATGGGAGACGGTGTTTGATGCAGCCGTCTATCCTACCATCGAGAACAATATG
CGGCCCGAGGAGATTGGGAGAGATTTTCATGGCTGGATTTCTGCGTACGATGGGAGCCTGTTAGGGAACACAGCC
ATGAACGAGTGGCTCGACGACATAATCGAGACCATTCTTTGCTGCAACGGTCAGCGTCTACTGGATGTACTCGAG
CTCGGCACCGGTTCTGGCATGATGCTCTTCAACTTGGCAAAACGACTGCGCTCATATATCGGCATCGAGCTCACC
CAAGCCGCCGTTGAATTCGTCACGGCTATAACAAAGTCGATGCCCGAACTGGCAAGCAAAGTGCTTGTGCGTCAT
GGCACAGCGACTGACTTGCATCTGTTCGCCTCGTGTTCCCCCGATCTGGTCATTATCAACTCAGTCGCACAATAC
TTCCCGAGCCGAGATTACCTGCTCAAGGTAGTGGAGAACACTCTGGCCCTCAAGGGCGTGCTGATAATCGTCTTC
GGCGACGTGAGGTCTTACGCGCTTGAGGAGGAATTCTTCGTCAGCAAAGCACTCTGCAAGCTCGGTGGCAACGCA
AGCAAGGAACAAGTCCGACAAAAAGTGGTGGAAATGTCGCGGGCCGAGCTGGAGCTGCTCATTGATCCGGCCTTT
TTCACAAGCCTGCAAGACCGTTTTCCTCAACTCATAGAACACGTCGAAATTCTGCCCAAGAAGATGAAAGAGCCA
GGCCTCGGCAGAAGATCCACGACGTGA
Transcript >Hirsu2|3749
ATGGATCAAAAAGTCGCAAGCCTACTCCGCAGCCATGAATTCATCGAGGATGTCGCTGTGCAGTGGCAAGATGAT
GACATGACCGCTTTTGTCACCCTACGCAAGCTTGCGATTGAGTATTACCAAGGCCTTGCGGGCATGGGCGATGGA
TTCGCGTCTCAGCAGGTAGAGCTATGGGAGACGGTGTTTGATGCAGCCGTCTATCCTACCATCGAGAACAATATG
CGGCCCGAGGAGATTGGGAGAGATTTTCATGGCTGGATTTCTGCGTACGATGGGAGCCTGTTAGGGAACACAGCC
ATGAACGAGTGGCTCGACGACATAATCGAGACCATTCTTTGCTGCAACGGTCAGCGTCTACTGGATGTACTCGAG
CTCGGCACCGGTTCTGGCATGATGCTCTTCAACTTGGCAAAACGACTGCGCTCATATATCGGCATCGAGCTCACC
CAAGCCGCCGTTGAATTCGTCACGGCTATAACAAAGTCGATGCCCGAACTGGCAAGCAAAGTGCTTGTGCGTCAT
GGCACAGCGACTGACTTGCATCTGTTCGCCTCGTGTTCCCCCGATCTGGTCATTATCAACTCAGTCGCACAATAC
TTCCCGAGCCGAGATTACCTGCTCAAGGTAGTGGAGAACACTCTGGCCCTCAAGGGCGTGCTGATAATCGTCTTC
GGCGACGTGAGGTCTTACGCGCTTGAGGAGGAATTCTTCGTCAGCAAAGCACTCTGCAAGCTCGGTGGCAACGCA
AGCAAGGAACAAGTCCGACAAAAAGTGGTGGAAATGTCGCGGGCCGAGCTGGAGCTGCTCATTGATCCGGCCTTT
TTCACAAGCCTGCAAGACCGTTTTCCTCAACTCATAGAACACGTCGAAATTCTGCCCAAGAAGATGAAAGAGCCA
GGCCTCGGCAGAAGATCCACGACGTGA
Gene >Hirsu2|3749
ATGGATCAAAAAGTCGCAAGCCTACTCCGCAGCCATGAATTCATCGAGGATGTCGCTGTGCAGTGGCAAGATGAT
GACATGACCGCTTTTGTCACCCTACGCAAGCTTGCGATTGAGTATTACCAAGGCCTTGCGGGCATGGGCGATGGA
TTCGCGTCTCAGCAGGTAGAGCTATGGGAGACGGTGTTTGATGCAGCCGTCTATCCTACCATCGAGAACAATATG
CGGCCCGAGGAGATTGGGAGAGATTTTCATGGCTGGATTTCTGCGTACGATGGGAGCCTGTTAGGGAACACAGCC
ATGAACGAGTGGCTCGACGACATAATCGAGACCATTCTTTGCTGCAACGGTCAGCGTCTACTGGATGTACTCGAG
CTCGGCACCGGTTCTGGCATGATGCTCTTCAACTTGGCAAAACGACTGCGCTCATATATCGGCATCGAGCTCACC
CAAGCCGCCGTTGAATTCGTCACGGCTATAACAAAGTCGATGCCCGAACTGGCAAGCAAAGTGCTTGTGCGTCAT
GGCACAGCGACTGACTTGCATCTGTTCGCCTCGTGTTCCCCCGATCTGGTCATTATCAACTCAGTCGCACAATAC
TTCCCGAGCCGAGATTACCTGCTCAAGGTAGTGGAGAACACTCTGGCCCTCAAGGGCGTGCTGATAATCGTCTTC
GGCGACGTGAGGTCTTACGCGCTTGAGGAGGAATTCTTCGTCAGCAAAGCACTCTGCAAGCTCGGTGGCAACGCA
AGCAAGGAACAAGTCCGACAAAAAGTGGTGGAAATGTCGCGGGCCGAGCTGGAGCTGCTCATTGATCCGGCCTTT
TTCACAAGCCTGCAAGACCGTTTTCCTCAACTCATAGAACACGTCGAAATTCTGCCCAAGAAGATGAAAGTGACT
AACGAGCTGAGCTGCTATCGGTATACGGCTGTGATTCATGTTGCAGGAGCCAGGCCTCGGCAGAAGATCCACGAC
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail