Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3748
Gene name
LocationContig_20:33312..37748
Strand+
Gene length (bp)4436
Transcript length (bp)4314
Coding sequence length (bp)4314
Protein length (aa) 1438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 7.9E-20 599 733
PF00005 ABC_tran ABC transporter 1.7E-24 1208 1353
PF00664 ABC_membrane ABC transporter transmembrane region 1.5E-06 280 538
PF00664 ABC_membrane ABC transporter transmembrane region 2.5E-24 883 1129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 25 1410 2.0E-173
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 25 1416 2.0E-172
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 100 1411 3.0E-170
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 285 1410 1.0E-169
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 1 1412 4.0E-168
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 25 1410 2.0E-173
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 25 1416 2.0E-172
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 100 1411 3.0E-170
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 285 1410 1.0E-169
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 1 1412 4.0E-168
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 1 1412 8.0E-168
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 1 1410 4.0E-166
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 1 1412 8.0E-166
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 13 1411 1.0E-163
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 4 1412 9.0E-161
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 1 1412 1.0E-160
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 1 1412 2.0E-160
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 100 1411 4.0E-160
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 237 1412 2.0E-150
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 191 1416 5.0E-150
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 192 1416 8.0E-147
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 188 1416 3.0E-146
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 116 1416 6.0E-145
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 201 1416 5.0E-142
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 193 1414 6.0E-142
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 191 1416 1.0E-141
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 192 1416 1.0E-140
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 193 1430 2.0E-140
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 193 1430 2.0E-138
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 190 1427 6.0E-138
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 192 1423 1.0E-137
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 192 1423 1.0E-137
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 193 1436 3.0E-137
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 193 1419 1.0E-136
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 234 1416 1.0E-136
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 205 1416 2.0E-136
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 180 1423 2.0E-136
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 193 1414 3.0E-136
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 193 1419 8.0E-136
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 304 1414 8.0E-135
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 599 1414 3.0E-134
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 205 1423 3.0E-134
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 200 1423 4.0E-134
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 338 1413 5.0E-134
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 338 1413 8.0E-134
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 286 1423 2.0E-133
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 179 1437 3.0E-133
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 196 1416 3.0E-133
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 599 1414 1.0E-132
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 367 1427 2.0E-132
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 338 1413 7.0E-132
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 599 1414 2.0E-131
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 338 1416 8.0E-131
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 193 1419 7.0E-130
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 201 1412 1.0E-129
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 338 1416 3.0E-129
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 135 1413 4.0E-129
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 278 1409 1.0E-128
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 338 1416 2.0E-128
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 338 1416 5.0E-127
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 190 1421 5.0E-126
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 287 1413 2.0E-125
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 207 1422 1.0E-124
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 595 1426 1.0E-123
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 192 1428 1.0E-123
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 190 1416 6.0E-123
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 188 1428 2.0E-121
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 599 1416 4.0E-120
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 184 1404 5.0E-120
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 277 1410 6.0E-120
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 439 1412 1.0E-119
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 193 1425 3.0E-119
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 189 1412 1.0E-118
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 192 1414 2.0E-118
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 189 1412 4.0E-118
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 193 1430 2.0E-115
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 428 1411 4.0E-109
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 428 1411 7.0E-109
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 428 1411 1.0E-108
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 599 1411 1.0E-103
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 574 1410 2.0E-98
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 846 1427 2.0E-91
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 838 1420 3.0E-84
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 843 1412 1.0E-81
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 956 1409 2.0E-76
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 908 1425 1.0E-72
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 908 1425 2.0E-72
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 910 1425 1.0E-71
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 908 1425 9.0E-71
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 923 1418 1.0E-70
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 25 807 4.0E-70
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 869 1425 9.0E-70
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 906 1427 9.0E-70
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 925 1425 9.0E-70
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 923 1425 2.0E-69
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 938 1425 3.0E-69
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 945 1418 3.0E-69
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 869 1425 3.0E-69
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 907 1425 4.0E-69
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 859 1425 9.0E-69
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 907 1425 1.0E-68
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 907 1425 1.0E-68
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 907 1425 1.0E-68
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 907 1425 1.0E-68
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 906 1425 1.0E-68
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 907 1425 2.0E-68
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 869 1425 2.0E-68
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 869 1425 2.0E-68
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 907 1425 2.0E-68
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 923 1425 2.0E-68
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 863 1425 2.0E-68
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 863 1425 2.0E-68
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 908 1432 3.0E-68
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 906 1425 4.0E-68
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 906 1425 5.0E-68
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 906 1425 7.0E-68
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 923 1425 1.0E-67
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 863 1425 2.0E-67
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 908 1430 4.0E-67
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 923 1425 9.0E-67
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 908 1425 1.0E-66
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 897 1425 1.0E-66
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 945 1425 1.0E-66
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 906 1425 2.0E-66
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 906 1427 3.0E-66
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 4 808 1.0E-65
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 739 1425 1.0E-65
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 932 1425 6.0E-65
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1156 1411 5.0E-49
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 428 1117 2.0E-47
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 1179 1413 9.0E-45
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 189 798 1.0E-44
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 189 798 1.0E-44
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 189 798 1.0E-44
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 189 798 1.0E-44
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 189 798 1.0E-44
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 189 798 1.0E-44
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 189 798 1.0E-44
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 189 798 1.0E-44
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 189 798 1.0E-44
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 189 798 2.0E-44
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 189 798 2.0E-44
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 189 798 2.0E-44
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 189 798 3.0E-44
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 189 798 4.0E-44
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 189 798 4.0E-44
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 189 798 4.0E-44
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 189 798 6.0E-44
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 576 1412 6.0E-44
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 189 831 9.0E-44
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 189 798 1.0E-43
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 194 872 2.0E-43
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 189 798 2.0E-43
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 189 800 2.0E-43
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 570 1412 3.0E-43
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 189 798 5.0E-43
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 189 800 7.0E-43
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 189 798 8.0E-43
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 189 800 1.0E-42
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 576 1412 1.0E-42
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 189 798 2.0E-42
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 189 800 4.0E-42
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 189 798 4.0E-42
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 189 798 6.0E-42
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 189 798 1.0E-41
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 189 798 2.0E-41
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 189 798 2.0E-41
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 189 798 2.0E-41
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 863 1412 2.0E-41
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 189 798 4.0E-41
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 189 798 4.0E-41
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 189 800 8.0E-41
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 189 798 1.0E-40
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 189 800 1.0E-40
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 576 1412 1.0E-40
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 576 1412 1.0E-40
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 532 1412 3.0E-40
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 945 1421 6.0E-40
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 189 798 1.0E-39
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 910 1419 8.0E-38
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 910 1419 9.0E-38
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 957 1419 2.0E-37
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 943 1419 7.0E-37
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 189 798 1.0E-36
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 957 1419 1.0E-36
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 189 798 2.0E-36
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 957 1419 6.0E-36
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 914 1419 1.0E-35
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 945 1420 1.0E-35
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 915 1410 1.0E-35
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 589 798 3.0E-35
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 600 1412 4.0E-35
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 910 1419 9.0E-35
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 954 1419 1.0E-34
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 957 1419 1.0E-34
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 957 1419 1.0E-34
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 957 1419 1.0E-34
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 943 1419 2.0E-34
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 943 1419 2.0E-34
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 945 1419 2.0E-34
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 910 1419 3.0E-34
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 943 1419 7.0E-34
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 943 1419 7.0E-34
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 943 1419 7.0E-34
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 590 1413 7.0E-34
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 905 1411 8.0E-34
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 943 1419 8.0E-34
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 915 1419 2.0E-33
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 915 1419 3.0E-33
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 943 1419 5.0E-33
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 943 1419 8.0E-33
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 945 1402 2.0E-32
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 943 1419 2.0E-32
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 943 1419 2.0E-32
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 943 1419 2.0E-32
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 943 1419 2.0E-32
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 943 1419 2.0E-32
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 850 1410 2.0E-32
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 958 1411 2.0E-32
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 945 1430 2.0E-32
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 958 1421 2.0E-32
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 909 1419 3.0E-32
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 909 1419 3.0E-32
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 909 1419 3.0E-32
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 939 1419 7.0E-32
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 939 1419 7.0E-32
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 939 1419 7.0E-32
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 939 1419 7.0E-32
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 939 1419 7.0E-32
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 939 1419 7.0E-32
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 939 1419 7.0E-32
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 939 1419 7.0E-32
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 958 1420 1.0E-31
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 1109 1411 1.0E-31
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 1109 1411 1.0E-31
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 912 1419 1.0E-31
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 943 1419 2.0E-31
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 840 1429 4.0E-31
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1187 1410 4.0E-31
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 945 1419 7.0E-31
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 939 1419 8.0E-31
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 920 1413 1.0E-30
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 945 1419 1.0E-30
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 1147 1412 1.0E-30
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 1135 1436 2.0E-30
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 943 1419 2.0E-30
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 913 1410 3.0E-30
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 945 1419 3.0E-30
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 910 1427 3.0E-30
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 1188 1419 4.0E-30
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 943 1419 4.0E-30
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1152 1412 4.0E-30
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 943 1419 5.0E-30
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 912 1395 6.0E-30
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 1184 1414 7.0E-30
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 913 1410 7.0E-30
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 913 1410 7.0E-30
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 860 1419 1.0E-29
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 1188 1427 1.0E-29
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 1135 1436 1.0E-29
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 1188 1419 2.0E-29
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 1152 1412 3.0E-29
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 944 1422 5.0E-29
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 957 1411 5.0E-29
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 957 1411 5.0E-29
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 957 1411 5.0E-29
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 890 1413 6.0E-29
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1188 1420 6.0E-29
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1188 1420 6.0E-29
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 1188 1420 7.0E-29
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1188 1420 8.0E-29
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1188 1420 8.0E-29
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1188 1420 8.0E-29
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 853 1416 8.0E-29
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1188 1420 8.0E-29
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 1188 1420 8.0E-29
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 1188 1420 9.0E-29
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 1135 1416 1.0E-28
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 914 1402 2.0E-28
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 890 1413 3.0E-28
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 918 1424 3.0E-28
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 1188 1420 3.0E-28
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 1029 1421 3.0E-28
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 890 1410 3.0E-28
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 1188 1420 4.0E-28
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 945 1413 4.0E-28
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 945 1413 7.0E-28
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 1147 1428 9.0E-28
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 1152 1429 9.0E-28
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 963 1422 9.0E-28
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1147 1428 1.0E-27
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 954 1413 1.0E-27
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 888 1418 1.0E-27
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 1147 1428 1.0E-27
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 918 1412 1.0E-27
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 945 1412 2.0E-27
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 902 1419 2.0E-27
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 945 1429 2.0E-27
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 945 1412 2.0E-27
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 954 1419 2.0E-27
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 966 1402 2.0E-27
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 1135 1416 2.0E-27
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 943 1413 2.0E-27
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 1135 1431 3.0E-27
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 945 1420 3.0E-27
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 949 1411 3.0E-27
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 945 1427 3.0E-27
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 1148 1420 3.0E-27
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 1147 1420 4.0E-27
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 945 1431 5.0E-27
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 1147 1428 5.0E-27
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 1126 1420 5.0E-27
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 1126 1420 5.0E-27
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 957 1400 6.0E-27
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 1189 1419 6.0E-27
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 945 1412 6.0E-27
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 860 1419 7.0E-27
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 600 798 8.0E-27
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 945 1431 8.0E-27
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 899 1413 8.0E-27
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 959 1418 1.0E-26
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 943 1413 1.0E-26
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 1135 1431 1.0E-26
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 1126 1419 1.0E-26
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 957 1412 2.0E-26
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 1187 1419 2.0E-26
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1189 1421 2.0E-26
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 914 1402 2.0E-26
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1100 1413 2.0E-26
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 957 1412 2.0E-26
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 957 1412 2.0E-26
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 1132 1418 2.0E-26
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 1147 1421 2.0E-26
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 957 1412 2.0E-26
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 943 1400 3.0E-26
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1186 1422 4.0E-26
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 945 1420 4.0E-26
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 296 807 4.0E-26
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 1032 1429 5.0E-26
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 849 1419 7.0E-26
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 1048 1422 7.0E-26
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 911 1433 8.0E-26
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 945 1420 8.0E-26
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 1204 1428 8.0E-26
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 911 1419 9.0E-26
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 945 1412 1.0E-25
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 1147 1421 1.0E-25
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 1187 1419 2.0E-25
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 957 1412 2.0E-25
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 851 1432 2.0E-25
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 1188 1410 2.0E-25
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 945 1429 2.0E-25
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 1180 1419 2.0E-25
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 1187 1419 3.0E-25
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 945 1411 5.0E-25
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 945 1420 7.0E-25
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 1176 1428 8.0E-25
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1190 1413 8.0E-25
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 1189 1419 9.0E-25
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 1188 1410 1.0E-24
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 1186 1421 2.0E-24
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1160 1434 2.0E-24
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 1127 1416 2.0E-24
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 954 1400 2.0E-24
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 1119 1421 3.0E-24
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 1188 1425 3.0E-24
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 1189 1412 3.0E-24
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 1188 1429 4.0E-24
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 1108 1420 4.0E-24
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 1108 1420 4.0E-24
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 1188 1429 4.0E-24
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 1126 1429 4.0E-24
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 949 1413 5.0E-24
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 1189 1412 5.0E-24
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 1189 1412 5.0E-24
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 1189 1412 5.0E-24
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 1135 1426 5.0E-24
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1191 1414 5.0E-24
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 903 1405 6.0E-24
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 949 1413 9.0E-24
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 943 1419 2.0E-23
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 1180 1419 2.0E-23
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 894 1414 2.0E-23
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 911 1433 2.0E-23
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 951 1416 2.0E-23
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1175 1431 2.0E-23
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1135 1402 2.0E-23
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 943 1405 3.0E-23
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1177 1413 3.0E-23
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 943 1411 3.0E-23
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 1189 1419 3.0E-23
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 945 1419 3.0E-23
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 1188 1411 3.0E-23
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 945 1411 3.0E-23
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 581 817 3.0E-23
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 1156 1419 4.0E-23
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 1182 1421 4.0E-23
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 1182 1421 4.0E-23
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 1182 1421 4.0E-23
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 1147 1420 4.0E-23
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 1121 1424 4.0E-23
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 1208 1420 5.0E-23
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1208 1420 5.0E-23
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 1188 1435 6.0E-23
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 1188 1435 6.0E-23
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 1188 1435 6.0E-23
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 1186 1411 8.0E-23
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 1188 1435 8.0E-23
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 1135 1430 9.0E-23
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 1189 1411 9.0E-23
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 1189 1411 9.0E-23
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 1189 1411 9.0E-23
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 945 1411 1.0E-22
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1167 1402 1.0E-22
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 1132 1422 1.0E-22
sp|Q9FVV9|NAP5_ARATH Probable non-intrinsic ABC protein 5 OS=Arabidopsis thaliana GN=NAP5 PE=2 SV=1 673 850 1.0E-22
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 1149 1429 1.0E-22
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 1105 1420 1.0E-22
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 1186 1416 1.0E-22
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1190 1410 2.0E-22
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 1156 1419 2.0E-22
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1188 1429 2.0E-22
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 1189 1421 2.0E-22
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 1186 1416 2.0E-22
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 1168 1413 2.0E-22
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 1135 1410 2.0E-22
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1188 1421 2.0E-22
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1140 1431 3.0E-22
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1140 1431 3.0E-22
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 1052 1400 3.0E-22
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1188 1413 3.0E-22
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 1180 1419 3.0E-22
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 1177 1411 4.0E-22
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 1126 1420 4.0E-22
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 1177 1411 4.0E-22
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 1186 1401 5.0E-22
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 909 1413 5.0E-22
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 445 818 6.0E-22
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 1142 1419 7.0E-22
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 1142 1419 7.0E-22
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 1142 1419 7.0E-22
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1188 1413 8.0E-22
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 1188 1410 8.0E-22
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 909 1435 9.0E-22
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 581 808 1.0E-21
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 908 1413 1.0E-21
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1188 1421 1.0E-21
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 871 1413 1.0E-21
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 1126 1420 2.0E-21
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 1207 1436 2.0E-21
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 1176 1421 2.0E-21
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 581 798 2.0E-21
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 1190 1401 2.0E-21
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 1208 1412 2.0E-21
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1177 1420 2.0E-21
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 530 808 2.0E-21
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 1188 1412 3.0E-21
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 1180 1428 3.0E-21
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 1189 1430 3.0E-21
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 1188 1413 4.0E-21
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 1188 1413 4.0E-21
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 949 1411 4.0E-21
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 949 1411 4.0E-21
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1189 1412 4.0E-21
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 1187 1414 5.0E-21
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1188 1410 5.0E-21
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 1189 1418 6.0E-21
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 949 1412 6.0E-21
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 949 1412 6.0E-21
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1188 1413 6.0E-21
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1185 1420 6.0E-21
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1188 1435 7.0E-21
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 1087 1425 8.0E-21
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 1188 1431 8.0E-21
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 1189 1419 8.0E-21
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1140 1428 1.0E-20
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 489 814 1.0E-20
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 1140 1411 1.0E-20
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1151 1411 1.0E-20
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1135 1410 1.0E-20
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 785 1110 1.0E-20
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 524 808 2.0E-20
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 1189 1429 2.0E-20
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 949 1412 2.0E-20
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 949 1412 2.0E-20
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1188 1413 2.0E-20
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 1208 1409 2.0E-20
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 445 808 2.0E-20
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 536 803 2.0E-20
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 536 803 2.0E-20
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 536 803 2.0E-20
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 1181 1412 3.0E-20
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 1130 1429 3.0E-20
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 1188 1429 3.0E-20
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 1121 1402 3.0E-20
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 1188 1414 3.0E-20
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 1204 1425 3.0E-20
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 1189 1419 3.0E-20
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 581 818 3.0E-20
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 541 808 5.0E-20
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 1188 1420 5.0E-20
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 1160 1429 5.0E-20
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 1188 1411 7.0E-20
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 1188 1425 8.0E-20
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 572 786 8.0E-20
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 581 818 8.0E-20
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 1190 1398 9.0E-20
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 1188 1425 9.0E-20
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 1188 1420 1.0E-19
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 910 1413 1.0E-19
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 1188 1429 1.0E-19
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 1188 1436 2.0E-19
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 581 803 2.0E-19
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 1188 1420 2.0E-19
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 951 1416 2.0E-19
sp|Q03EE4|ECFA_PEDPA Energy-coupling factor transporter ATP-binding protein EcfA OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=ecfA PE=3 SV=1 1191 1430 2.0E-19
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 1188 1420 2.0E-19
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 575 808 3.0E-19
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 581 834 3.0E-19
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 1191 1435 3.0E-19
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 910 1392 3.0E-19
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 577 824 3.0E-19
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 589 793 4.0E-19
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 1174 1411 4.0E-19
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 1188 1411 4.0E-19
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 1204 1419 4.0E-19
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 1189 1420 4.0E-19
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 581 798 4.0E-19
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 1168 1413 4.0E-19
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1188 1412 5.0E-19
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 1159 1420 7.0E-19
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 448 798 7.0E-19
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 935 1405 9.0E-19
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 924 1392 1.0E-18
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 581 808 1.0E-18
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 588 808 1.0E-18
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 500 808 1.0E-18
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 1204 1410 1.0E-18
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 1166 1436 2.0E-18
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 443 808 2.0E-18
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 448 798 2.0E-18
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 448 798 2.0E-18
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 1109 1427 2.0E-18
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 448 798 2.0E-18
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 448 798 2.0E-18
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 448 798 2.0E-18
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 448 798 2.0E-18
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 448 798 2.0E-18
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 448 798 2.0E-18
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 1210 1424 2.0E-18
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 492 803 3.0E-18
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 581 798 3.0E-18
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 1131 1416 3.0E-18
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 505 803 3.0E-18
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 581 808 3.0E-18
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 563 808 4.0E-18
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 448 798 4.0E-18
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 532 803 4.0E-18
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 433 799 5.0E-18
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1205 1413 5.0E-18
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 547 808 6.0E-18
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1076 1419 8.0E-18
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 1188 1419 1.0E-17
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1208 1410 1.0E-17
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 581 808 1.0E-17
sp|Q1WSB8|ECFA1_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA1 PE=3 SV=1 1191 1416 1.0E-17
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 1188 1413 1.0E-17
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 448 798 1.0E-17
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 557 798 1.0E-17
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 267 808 2.0E-17
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 1204 1413 2.0E-17
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 529 851 2.0E-17
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 553 798 2.0E-17
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 1204 1410 2.0E-17
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 412 812 2.0E-17
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 1208 1423 2.0E-17
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 516 803 3.0E-17
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 516 803 3.0E-17
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 516 803 3.0E-17
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 1188 1428 3.0E-17
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 499 816 3.0E-17
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1205 1413 3.0E-17
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 525 816 3.0E-17
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 578 808 3.0E-17
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1185 1413 3.0E-17
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 581 808 4.0E-17
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 1167 1436 4.0E-17
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 1171 1435 4.0E-17
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 514 803 4.0E-17
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 443 808 4.0E-17
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1185 1413 4.0E-17
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1188 1410 5.0E-17
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 1176 1421 5.0E-17
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 481 803 5.0E-17
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 1188 1424 5.0E-17
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 533 808 6.0E-17
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1172 1413 6.0E-17
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 578 808 6.0E-17
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 499 816 7.0E-17
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 499 816 7.0E-17
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 499 816 7.0E-17
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 499 816 7.0E-17
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 499 816 7.0E-17
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 499 816 7.0E-17
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 499 816 7.0E-17
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 499 816 7.0E-17
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 267 808 7.0E-17
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 262 803 7.0E-17
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 578 800 8.0E-17
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 448 800 8.0E-17
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1204 1413 8.0E-17
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 538 798 1.0E-16
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 582 803 1.0E-16
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 1142 1399 1.0E-16
sp|P72479|OPPF_STRMU Oligopeptide transport ATP-binding protein OppF OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=oppF PE=3 SV=2 1187 1407 1.0E-16
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 553 803 1.0E-16
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 517 808 1.0E-16
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 530 803 2.0E-16
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 530 803 2.0E-16
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 325 808 2.0E-16
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 581 807 2.0E-16
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 599 814 2.0E-16
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 1188 1424 2.0E-16
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 966 1401 2.0E-16
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 1185 1413 2.0E-16
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 576 808 2.0E-16
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 576 808 2.0E-16
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 519 808 2.0E-16
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 262 808 2.0E-16
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 276 808 3.0E-16
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 1188 1419 3.0E-16
sp|Q9CIS9|ECFA1_LACLA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ecfA1 PE=3 SV=1 1191 1419 3.0E-16
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 519 808 3.0E-16
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 1166 1402 4.0E-16
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 945 1400 4.0E-16
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 579 803 4.0E-16
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 579 803 4.0E-16
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 579 803 4.0E-16
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 1189 1419 4.0E-16
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 557 798 4.0E-16
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 404 808 4.0E-16
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 1204 1410 4.0E-16
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 1188 1424 5.0E-16
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 557 798 5.0E-16
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 531 803 5.0E-16
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 469 803 6.0E-16
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 574 808 6.0E-16
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 1155 1427 6.0E-16
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 557 798 7.0E-16
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 514 803 9.0E-16
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 429 787 9.0E-16
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 1053 1428 9.0E-16
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 581 805 9.0E-16
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 581 805 9.0E-16
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 442 803 1.0E-15
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 442 803 1.0E-15
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 267 808 1.0E-15
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 519 816 1.0E-15
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 560 808 1.0E-15
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 1188 1413 1.0E-15
sp|Q97EK8|ECFA1_CLOAB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ecfA1 PE=3 SV=1 1191 1419 1.0E-15
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 1191 1418 1.0E-15
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 557 798 1.0E-15
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 533 808 1.0E-15
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 516 808 2.0E-15
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 503 808 2.0E-15
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 503 808 2.0E-15
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 503 808 2.0E-15
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 498 808 2.0E-15
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 528 825 2.0E-15
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 576 808 2.0E-15
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 481 803 2.0E-15
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 529 808 2.0E-15
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 530 810 2.0E-15
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 581 800 2.0E-15
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 1227 1420 2.0E-15
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 1191 1411 2.0E-15
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 538 798 2.0E-15
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 503 808 3.0E-15
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 1191 1413 3.0E-15
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 1191 1411 3.0E-15
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 503 808 4.0E-15
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 1215 1420 4.0E-15
sp|O32487|PSTB_ENTCL Phosphate import ATP-binding protein PstB OS=Enterobacter cloacae GN=pstB PE=3 SV=1 1189 1421 4.0E-15
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 1191 1402 4.0E-15
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 374 835 5.0E-15
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 503 803 5.0E-15
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 443 809 5.0E-15
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 1188 1420 5.0E-15
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 1208 1427 5.0E-15
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 1200 1419 5.0E-15
sp|Q98FL5|PSTB_RHILO Phosphate import ATP-binding protein PstB OS=Rhizobium loti (strain MAFF303099) GN=pstB PE=3 SV=1 1188 1422 5.0E-15
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 266 803 5.0E-15
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 519 808 6.0E-15
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1186 1430 6.0E-15
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 1191 1409 6.0E-15
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 581 803 7.0E-15
sp|Q62L74|PSTB_BURMA Phosphate import ATP-binding protein PstB OS=Burkholderia mallei (strain ATCC 23344) GN=pstB PE=3 SV=1 1186 1415 7.0E-15
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 1191 1420 7.0E-15
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 503 803 8.0E-15
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 536 808 8.0E-15
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 954 1430 8.0E-15
sp|Q2SUW7|PSTB_BURTA Phosphate import ATP-binding protein PstB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pstB PE=3 SV=1 1186 1415 8.0E-15
sp|Q63V79|PSTB_BURPS Phosphate import ATP-binding protein PstB OS=Burkholderia pseudomallei (strain K96243) GN=pstB PE=3 SV=1 1186 1415 8.0E-15
sp|Q3JTS8|PSTB_BURP1 Phosphate import ATP-binding protein PstB OS=Burkholderia pseudomallei (strain 1710b) GN=pstB PE=3 SV=1 1186 1415 8.0E-15
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 1053 1428 8.0E-15
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 531 803 8.0E-15
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 560 808 9.0E-15
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 587 809 9.0E-15
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 587 809 9.0E-15
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 1111 1410 9.0E-15
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 529 808 1.0E-14
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 599 808 1.0E-14
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 528 808 1.0E-14
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 304 808 1.0E-14
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 581 808 1.0E-14
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 538 798 1.0E-14
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 544 799 1.0E-14
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 520 850 1.0E-14
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 599 800 1.0E-14
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1018 1433 1.0E-14
sp|Q2KVN7|PSTB_BORA1 Phosphate import ATP-binding protein PstB OS=Bordetella avium (strain 197N) GN=pstB PE=3 SV=1 1188 1415 1.0E-14
sp|Q9PPV1|ECFA1_UREPA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ecfA1 PE=3 SV=1 1190 1419 1.0E-14
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 443 803 1.0E-14
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 516 808 1.0E-14
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 1208 1411 2.0E-14
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1208 1425 2.0E-14
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 581 825 2.0E-14
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 1188 1413 2.0E-14
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 449 800 2.0E-14
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 449 800 2.0E-14
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 449 800 2.0E-14
sp|Q8DMX9|ECFA1_STRR6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ecfA1 PE=3 SV=1 1188 1412 2.0E-14
sp|Q97N50|ECFA1_STRPN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ecfA1 PE=3 SV=1 1188 1412 2.0E-14
sp|Q04HV7|ECFA1_STRP2 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ecfA1 PE=3 SV=1 1188 1412 2.0E-14
sp|Q03PY5|ECFA1_LACBA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ecfA1 PE=1 SV=1 1191 1419 2.0E-14
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 599 835 2.0E-14
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 599 835 2.0E-14
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 503 808 2.0E-14
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 503 808 2.0E-14
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 503 808 2.0E-14
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 503 808 2.0E-14
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 503 808 2.0E-14
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 503 808 2.0E-14
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 503 808 2.0E-14
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 601 820 3.0E-14
sp|Q04EY5|ECFA1_OENOB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA1 PE=3 SV=1 1191 1436 3.0E-14
sp|Q6CYN3|PSTB2_PECAS Phosphate import ATP-binding protein PstB 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pstB2 PE=3 SV=1 1203 1421 3.0E-14
sp|Q8PY27|Y1037_METMA Putative ABC transporter ATP-binding protein MM_1037 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1037 PE=3 SV=1 1191 1419 3.0E-14
sp|Q38UT9|ECFA1_LACSS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA1 PE=3 SV=1 1191 1419 3.0E-14
sp|Q8RHL0|ECFA1_FUSNN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=ecfA1 PE=3 SV=1 1191 1400 3.0E-14
sp|Q032H4|ECFA1_LACLS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ecfA1 PE=3 SV=1 1191 1411 3.0E-14
sp|A2RI01|ECFA1_LACLM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ecfA1 PE=1 SV=1 1191 1411 3.0E-14
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 593 808 3.0E-14
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 593 808 3.0E-14
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 503 808 3.0E-14
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 503 808 3.0E-14
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 347 814 3.0E-14
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 581 808 4.0E-14
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 391 786 4.0E-14
sp|Q46ZA5|PSTB_CUPPJ Phosphate import ATP-binding protein PstB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pstB PE=3 SV=1 1188 1415 4.0E-14
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 1188 1413 4.0E-14
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 503 808 5.0E-14
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 581 808 5.0E-14
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 416 808 5.0E-14
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 594 808 5.0E-14
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 599 835 5.0E-14
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 560 803 5.0E-14
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 489 803 5.0E-14
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 581 800 6.0E-14
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 599 808 6.0E-14
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 582 802 6.0E-14
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 447 794 6.0E-14
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 1188 1430 6.0E-14
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 581 803 6.0E-14
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 1189 1421 6.0E-14
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 581 798 6.0E-14
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 529 808 7.0E-14
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 529 808 7.0E-14
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1206 1430 8.0E-14
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 493 808 9.0E-14
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 594 798 9.0E-14
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 529 798 9.0E-14
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 581 808 9.0E-14
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 305 808 9.0E-14
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 511 803 1.0E-13
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 502 803 1.0E-13
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 443 808 1.0E-13
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 563 808 1.0E-13
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 581 808 2.0E-13
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 500 808 2.0E-13
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 267 808 2.0E-13
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 463 798 2.0E-13
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 582 849 2.0E-13
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 576 798 2.0E-13
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 599 808 2.0E-13
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 582 803 2.0E-13
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 537 808 2.0E-13
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 503 803 2.0E-13
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 590 808 2.0E-13
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 821 1429 2.0E-13
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 582 808 2.0E-13
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 588 837 2.0E-13
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 517 809 3.0E-13
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 517 809 3.0E-13
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 517 809 3.0E-13
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 517 809 3.0E-13
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 463 798 3.0E-13
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 581 819 3.0E-13
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 421 808 3.0E-13
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 429 805 4.0E-13
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 481 793 4.0E-13
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 443 808 4.0E-13
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 590 808 4.0E-13
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 503 808 4.0E-13
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1206 1430 5.0E-13
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 581 806 5.0E-13
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 423 803 5.0E-13
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 568 803 6.0E-13
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 541 798 6.0E-13
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 484 803 6.0E-13
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 575 803 7.0E-13
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 593 808 7.0E-13
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 573 808 8.0E-13
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 530 803 8.0E-13
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 588 808 9.0E-13
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 313 803 9.0E-13
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 503 808 9.0E-13
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 503 808 9.0E-13
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 524 808 9.0E-13
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 599 801 9.0E-13
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 479 803 9.0E-13
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 533 803 1.0E-12
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 501 808 1.0E-12
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 599 832 1.0E-12
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 528 803 1.0E-12
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 509 808 1.0E-12
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 807 1432 1.0E-12
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 594 808 1.0E-12
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 590 812 1.0E-12
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 520 798 2.0E-12
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 443 808 2.0E-12
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 582 803 2.0E-12
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 582 803 2.0E-12
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 484 808 2.0E-12
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 511 803 2.0E-12
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 511 803 2.0E-12
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 511 803 2.0E-12
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 538 798 2.0E-12
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 807 1430 2.0E-12
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 834 1430 2.0E-12
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 599 808 2.0E-12
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 588 808 2.0E-12
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 590 808 2.0E-12
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 1208 1426 3.0E-12
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 530 803 3.0E-12
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 346 808 3.0E-12
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 534 808 3.0E-12
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 590 815 3.0E-12
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 1054 1423 3.0E-12
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 518 798 4.0E-12
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 361 810 4.0E-12
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 494 815 4.0E-12
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 599 808 5.0E-12
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 524 803 5.0E-12
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 607 798 5.0E-12
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 587 809 5.0E-12
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 587 809 5.0E-12
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 587 809 5.0E-12
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 581 803 5.0E-12
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 503 803 6.0E-12
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 429 805 6.0E-12
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 531 808 6.0E-12
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 582 808 6.0E-12
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 913 1424 6.0E-12
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 426 798 7.0E-12
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 599 803 8.0E-12
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 548 803 8.0E-12
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 548 803 8.0E-12
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 548 803 8.0E-12
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 517 808 9.0E-12
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 581 806 9.0E-12
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 525 808 9.0E-12
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 599 803 1.0E-11
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 581 808 1.0E-11
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 597 803 1.0E-11
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 361 808 1.0E-11
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 575 819 1.0E-11
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 599 803 1.0E-11
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 559 800 1.0E-11
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 604 786 1.0E-11
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 530 803 2.0E-11
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 580 786 2.0E-11
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 345 825 2.0E-11
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 546 808 2.0E-11
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 562 808 2.0E-11
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 524 803 2.0E-11
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 590 852 2.0E-11
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 599 816 2.0E-11
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 564 814 2.0E-11
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 599 803 3.0E-11
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 581 808 3.0E-11
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 524 803 3.0E-11
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 587 740 3.0E-11
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 587 740 3.0E-11
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 401 824 3.0E-11
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 932 1428 3.0E-11
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 306 814 4.0E-11
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 306 814 4.0E-11
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 538 808 4.0E-11
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 599 808 4.0E-11
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 541 798 4.0E-11
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 588 808 5.0E-11
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 306 803 5.0E-11
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 599 802 6.0E-11
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 597 803 6.0E-11
sp|P23596|PRTD_DICCH Proteases secretion ATP-binding protein PrtD OS=Dickeya chrysanthemi GN=prtD PE=3 SV=1 599 786 6.0E-11
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 484 823 6.0E-11
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 581 798 7.0E-11
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 494 804 7.0E-11
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 581 798 7.0E-11
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 551 803 7.0E-11
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 597 803 9.0E-11
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 314 798 1.0E-10
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 599 805 1.0E-10
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 599 786 1.0E-10
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 495 808 1.0E-10
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 599 803 1.0E-10
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 494 804 1.0E-10
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 581 808 1.0E-10
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1013 1430 1.0E-10
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 599 803 1.0E-10
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 306 814 1.0E-10
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 306 814 1.0E-10
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 484 815 2.0E-10
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 436 800 2.0E-10
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 616 800 2.0E-10
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 542 803 2.0E-10
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 593 803 2.0E-10
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 593 803 2.0E-10
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 1117 1426 2.0E-10
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 599 803 2.0E-10
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 581 798 3.0E-10
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 581 820 3.0E-10
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 599 816 3.0E-10
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 193 566 4.0E-10
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 590 803 4.0E-10
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 593 803 4.0E-10
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 361 810 5.0E-10
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 555 808 5.0E-10
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 1155 1412 6.0E-10
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 597 798 6.0E-10
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 489 808 6.0E-10
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 489 808 6.0E-10
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 593 806 6.0E-10
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 1018 1425 6.0E-10
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 590 838 6.0E-10
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 914 1429 7.0E-10
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1013 1430 7.0E-10
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 803 1424 8.0E-10
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 599 800 8.0E-10
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 1195 1426 8.0E-10
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 549 803 1.0E-09
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 599 800 1.0E-09
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 599 794 1.0E-09
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 439 808 1.0E-09
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 534 803 1.0E-09
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 524 742 2.0E-09
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 597 798 2.0E-09
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 541 798 2.0E-09
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 443 808 2.0E-09
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 591 803 2.0E-09
sp|Q6F1W5|ECFA1_MESFL Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ecfA1 PE=3 SV=1 570 818 2.0E-09
sp|Q8RCU0|PSTB1_CALS4 Phosphate import ATP-binding protein PstB 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB1 PE=3 SV=1 599 769 2.0E-09
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 900 1423 2.0E-09
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 534 803 2.0E-09
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1037 1410 3.0E-09
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 1207 1428 3.0E-09
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 903 1424 4.0E-09
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 576 852 6.0E-09
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1108 1428 6.0E-09
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1035 1413 7.0E-09
sp|Q46ZA5|PSTB_CUPPJ Phosphate import ATP-binding protein PstB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pstB PE=3 SV=1 599 772 7.0E-09
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 315 845 9.0E-09
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 903 1424 9.0E-09
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 575 815 1.0E-08
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 484 808 1.0E-08
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 1054 1423 1.0E-08
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 557 743 2.0E-08
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 534 803 2.0E-08
sp|O32487|PSTB_ENTCL Phosphate import ATP-binding protein PstB OS=Enterobacter cloacae GN=pstB PE=3 SV=1 599 779 2.0E-08
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1208 1413 2.0E-08
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 1208 1424 3.0E-08
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 803 1399 3.0E-08
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1126 1429 3.0E-08
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 1054 1423 3.0E-08
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 556 809 4.0E-08
sp|Q2KVN7|PSTB_BORA1 Phosphate import ATP-binding protein PstB OS=Bordetella avium (strain 197N) GN=pstB PE=3 SV=1 599 739 4.0E-08
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 1208 1424 5.0E-08
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 903 1424 5.0E-08
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 1188 1429 5.0E-08
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 484 808 6.0E-08
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 903 1424 6.0E-08
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 1208 1432 7.0E-08
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 1176 1424 7.0E-08
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 560 808 7.0E-08
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 502 805 7.0E-08
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 540 786 1.0E-07
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 903 1424 1.0E-07
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 502 805 1.0E-07
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 581 786 2.0E-07
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 1208 1424 2.0E-07
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 1208 1424 2.0E-07
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 1208 1400 2.0E-07
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 1208 1424 2.0E-07
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 1176 1424 2.0E-07
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 1176 1424 2.0E-07
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 1176 1424 2.0E-07
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 1176 1424 2.0E-07
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 594 786 2.0E-07
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 1176 1424 2.0E-07
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 1208 1424 2.0E-07
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 903 1424 2.0E-07
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 1208 1424 2.0E-07
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 408 808 3.0E-07
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 1176 1424 3.0E-07
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 1208 1424 3.0E-07
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 1208 1398 3.0E-07
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 1208 1424 3.0E-07
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 1208 1424 3.0E-07
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 1208 1424 3.0E-07
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 1208 1398 3.0E-07
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 599 799 4.0E-07
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 1108 1410 4.0E-07
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 1208 1424 4.0E-07
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 1208 1398 4.0E-07
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 1208 1398 4.0E-07
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 1208 1398 4.0E-07
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 572 803 5.0E-07
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 1208 1398 5.0E-07
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 1208 1400 5.0E-07
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 1208 1400 5.0E-07
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 599 798 5.0E-07
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 1208 1400 7.0E-07
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 1208 1429 7.0E-07
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 547 742 1.0E-06
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 1208 1424 2.0E-06
sp|Q8PY27|Y1037_METMA Putative ABC transporter ATP-binding protein MM_1037 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1037 PE=3 SV=1 582 794 2.0E-06
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 1115 1433 3.0E-06
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 448 798 4.0E-06
sp|Q03PY5|ECFA1_LACBA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=ecfA1 PE=1 SV=1 599 786 5.0E-06
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 1115 1433 6.0E-06
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1107 1426 7.0E-06
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 1208 1424 7.0E-06
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 587 783 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0055085 transmembrane transport Yes
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.5

Transmembrane Domains

Domain # Start End Length
1 33 52 19
2 65 87 22
3 97 119 22
4 128 147 19
5 157 179 22
6 199 221 22
7 271 293 22
8 306 328 22
9 402 421 19
10 487 509 22
11 524 542 18
12 871 893 22
13 908 930 22
14 986 1005 19
15 1009 1031 22
16 1095 1117 22
17 1127 1149 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3748
MASFCPSDLDDVWGPVVNECSRTFDFTLLFEQSILSTLPTTIFLILAWLRIWQLLRREQRLATGVVALAEILLVL
GMGGLQLALVALWSRDPDTRTRMSIAMAVISLLASLTMAPLFWLEHTRTIKPSLLLCSFLVLMTLLEMAQVRTLW
TIRRANGAIASCFTASYVIRATLLVFESLPKKLTRAVDIARSPEDKCGAVSRSFFLWLMPLIYAGFRRTLVVDDL
YAPPIDAAPGPLEEKLWRGWKRSKPGSRNRLLLVTVRALLPRLLTPIVPRLCMVGFMATTPILLSRLIRFLDDRP
ESPNDGYGLLGAYALVYIGLAVSNAWYFHQTFKFIACVRAGLVAMVYNRTMQLSTGAIDKSSAVTVMSADIERIA
LGIKTIHDIWANVIQVALAAWLLEKQTGVAIVLPLVVAAACGYGTLKISGAAGGQQANWLSKIEKRIEVTSRTLS
SIRSVKIIGLAPKLTDSIQRLRATELQAAASFRWWQVGALIMGFVPVMINPVLTFAIFIAVARGNSQALDASRMF
VSLSFLTIMSQPLSMLFQSGPQISSMIACFNRIGKFIETPEREFSVQDAGEKDADEIRICGVKFGWSPESTLDLR
NVHVSFPRGKLTMIIGPVGCGKSTLLKSLLGEVPHTQDSVVSMPSTSLAYCDQTPWIMNGTVKENITKFSGDDPE
YYNTVLTACALNKDLAQLPDGEVSKVGSKGISLSGGQKQRLALARALFARRDINLFDDVLSGLDATTGNQVFAHV
FGPDGLLKRNASTVILATHAVHFLPYADHIVCVGPGGDIVQQGSFSELSAADGYVRKLDIASIQSLPEVHFSPGS
PPDKDTESKATATTYTEQHEVTREDKKPGKPHGAFRYYIRSIGYTMAVLYVALAATYAFLYTFPYIWAKWWTDAN
AKDPWNRTAFYIGIYAMLQVLCLASLVLFAWHAVITIVVTSGLYLHHTLLSTTLQAPLSFFERTDTGVTLNRFSQ
DLQIVDNELPLAALNIACSGLIVVGQMLLIMNTSYWLALSFPAIILILWALQSVYLRTSRQLRHLDIETKAPLYS
QFVESLDGLVCIRAFGWQAPLKDLLYHHLERSQRPFYLLLVVQRWLGLVLDCLTAGFVLLLLGIVIIGLRHQVSP
GFAGVALANLINLSGSLTTVVNVWTQMETSIASIQRIRDFEKNVPSETKGLSTKAVPSDWPRKGAIDIENLVATY
KDGEITALKNITMSIKPGEKIGVCGRTGSGKTSLALALFRMIGIEEGSITVDGVDISHVDPNTVRSILNGIPQDP
FFMAGTVRLNADPHGTKSDEEITEALVSVHLDHVIKNKGGLDVEMEDGLFSQGEKQLFCLARAILKGSKIVVLDE
ATSNIDIKTEGLINKVIESEFKDATVVTIAHRLKAILGSDRIAVLEAGELVEFDSPDALLSRESRLKQLLDGYER
SNDEHPPILEKH*
Coding >Hirsu2|3748
ATGGCGAGTTTCTGCCCATCCGACCTAGATGACGTCTGGGGACCGGTTGTGAACGAATGCTCTCGGACCTTTGAC
TTCACCCTGCTCTTTGAACAGTCAATACTCTCGACTTTGCCAACGACAATTTTCCTCATTCTCGCCTGGTTGAGG
ATATGGCAGCTCCTGCGCAGGGAACAGAGGCTGGCAACGGGCGTCGTCGCCCTTGCCGAGATTCTGCTGGTCCTG
GGCATGGGAGGATTGCAGTTGGCGCTTGTGGCTCTATGGTCTCGCGATCCCGACACCAGGACCCGGATGTCCATC
GCTATGGCCGTCATCTCTCTGCTTGCCAGTCTGACAATGGCACCGCTTTTCTGGCTTGAGCACACAAGAACCATC
AAGCCGTCTCTTTTGCTCTGCTCCTTCCTAGTTCTCATGACGCTGCTGGAGATGGCGCAGGTCCGCACCTTGTGG
ACGATACGTCGTGCCAACGGAGCCATCGCCTCCTGTTTCACTGCTTCATATGTCATCCGAGCTACACTTCTCGTC
TTCGAAAGCCTTCCGAAGAAGTTGACTCGCGCCGTCGATATCGCACGTAGCCCCGAGGACAAGTGCGGCGCCGTC
TCGCGCAGCTTTTTCCTGTGGCTGATGCCCTTGATATACGCAGGCTTCCGGAGAACACTGGTAGTGGACGACTTG
TACGCGCCACCCATCGACGCAGCGCCTGGTCCTTTGGAGGAGAAGCTTTGGCGAGGATGGAAGAGATCCAAGCCA
GGGTCGAGGAACAGGCTTTTGCTAGTCACCGTCAGGGCCCTGTTGCCGCGTTTACTCACACCTATAGTTCCAAGA
CTCTGCATGGTCGGTTTCATGGCCACGACGCCTATCCTCTTGTCACGTCTGATCCGCTTCCTGGATGACCGTCCC
GAGTCGCCTAACGACGGCTACGGCCTGCTTGGCGCCTACGCTCTTGTTTACATCGGCCTTGCCGTCTCTAATGCC
TGGTACTTTCACCAGACCTTCAAGTTCATCGCCTGTGTTCGAGCCGGACTTGTGGCAATGGTATACAACCGAACC
ATGCAGCTGAGCACAGGGGCTATCGACAAATCGTCAGCCGTGACCGTCATGAGCGCCGACATCGAACGAATTGCC
CTCGGGATCAAGACCATTCACGACATCTGGGCCAACGTTATCCAAGTCGCCTTGGCCGCCTGGCTGCTCGAGAAA
CAGACGGGCGTCGCCATTGTCTTGCCCCTCGTTGTCGCCGCCGCCTGTGGCTACGGGACACTGAAAATCAGCGGA
GCGGCCGGGGGCCAGCAGGCAAACTGGCTTAGCAAGATCGAGAAGCGCATCGAAGTCACCAGCCGGACTTTATCA
TCCATTAGAAGTGTCAAGATAATTGGCCTCGCGCCCAAGTTGACAGACTCGATCCAGCGTCTGAGGGCTACAGAA
CTGCAAGCAGCAGCCAGTTTCCGCTGGTGGCAAGTTGGCGCGCTGATAATGGGGTTTGTGCCCGTCATGATAAAC
CCCGTCCTCACTTTTGCCATCTTCATCGCGGTGGCCCGCGGAAATTCGCAGGCGTTGGACGCCTCGAGGATGTTT
GTCTCATTATCTTTCTTAACCATCATGTCGCAACCGTTGAGCATGCTCTTCCAGTCTGGCCCTCAGATCTCGTCC
ATGATTGCCTGTTTTAATCGAATTGGAAAATTCATCGAGACTCCGGAACGAGAGTTTTCTGTCCAAGATGCTGGC
GAGAAGGATGCCGACGAGATACGAATTTGTGGCGTTAAGTTTGGCTGGTCACCCGAATCGACGCTGGATCTTCGA
AACGTTCACGTTTCGTTCCCTCGTGGCAAACTTACCATGATTATCGGACCTGTCGGATGTGGCAAGTCCACCTTG
CTGAAGAGTCTTCTTGGAGAGGTGCCGCACACCCAAGACTCGGTTGTGAGCATGCCGTCTACAAGCCTCGCGTAT
TGCGATCAGACACCCTGGATTATGAACGGCACGGTCAAGGAAAACATCACCAAGTTTTCTGGTGACGACCCGGAA
TACTATAATACCGTCTTGACTGCCTGCGCTCTGAACAAAGACCTCGCCCAGCTTCCTGACGGCGAAGTGTCCAAA
GTAGGGAGTAAGGGCATTAGCCTCAGCGGCGGCCAAAAGCAACGCCTAGCTCTCGCGCGCGCTCTCTTTGCTCGA
CGGGACATCAATCTGTTCGATGACGTCCTGAGCGGCCTCGATGCCACTACAGGAAATCAGGTTTTCGCGCATGTG
TTCGGGCCGGATGGACTCCTCAAGCGGAATGCATCTACCGTGATCCTCGCAACGCATGCGGTTCATTTCCTCCCG
TATGCAGACCACATCGTGTGCGTCGGGCCCGGTGGAGACATTGTCCAACAGGGGTCCTTCTCTGAGCTGAGTGCG
GCCGATGGCTATGTTCGCAAATTGGATATCGCGAGCATTCAAAGCCTTCCCGAAGTGCACTTCAGTCCCGGCAGC
CCGCCCGATAAGGACACGGAAAGCAAAGCCACGGCGACTACGTATACCGAGCAACATGAGGTTACCCGTGAAGAT
AAGAAGCCCGGGAAGCCACACGGAGCCTTTCGCTACTATATTCGGTCGATTGGATACACAATGGCTGTTCTTTAC
GTCGCACTTGCTGCCACATACGCCTTTCTCTACACGTTTCCGTATATATGGGCCAAGTGGTGGACCGATGCCAAT
GCCAAAGACCCTTGGAACCGCACAGCGTTTTACATTGGCATCTATGCCATGCTACAGGTCCTCTGCCTCGCCTCT
CTTGTTTTATTTGCTTGGCATGCCGTCATCACCATAGTGGTCACGTCCGGTCTCTATCTCCACCATACGCTGTTG
TCAACAACATTGCAGGCCCCTTTGTCCTTCTTTGAGAGAACGGACACGGGCGTCACGCTCAACAGATTCAGTCAG
GACCTGCAGATTGTGGACAATGAGCTTCCTCTGGCCGCTTTGAACATTGCGTGCAGTGGGCTCATTGTCGTCGGT
CAGATGCTCCTCATCATGAACACGTCTTACTGGCTTGCCCTCTCTTTCCCGGCCATCATCCTTATTCTCTGGGCA
TTGCAGAGCGTATATTTGCGCACTTCCAGACAGCTGAGACACCTCGACATCGAAACAAAAGCCCCTCTCTACTCG
CAGTTTGTCGAGTCTCTTGACGGTCTCGTCTGCATCCGCGCCTTTGGGTGGCAGGCGCCACTTAAAGACCTTCTC
TACCATCATCTCGAGCGGTCTCAGCGGCCGTTTTATCTTCTTCTTGTCGTCCAGAGGTGGCTTGGCCTTGTTCTT
GACTGCCTCACGGCTGGGTTTGTCCTTCTGCTTCTCGGAATCGTCATTATTGGCTTGCGTCACCAGGTCAGTCCC
GGTTTTGCCGGTGTCGCCTTGGCAAATCTCATCAATTTGAGTGGTTCCTTGACCACTGTCGTCAATGTTTGGACA
CAGATGGAGACATCCATTGCTTCCATCCAGAGAATTCGTGACTTCGAGAAGAATGTTCCTTCCGAGACCAAGGGA
CTTAGCACCAAGGCAGTACCGTCGGACTGGCCGAGAAAAGGAGCAATTGACATCGAGAATCTAGTCGCAACATAC
AAAGATGGCGAAATTACGGCGCTGAAAAACATAACAATGAGCATCAAGCCTGGCGAGAAGATTGGTGTTTGTGGC
CGGACGGGCAGTGGCAAGACATCCCTGGCCCTTGCACTCTTCCGGATGATTGGCATCGAGGAGGGCTCCATCACG
GTTGACGGTGTTGACATCTCACACGTCGACCCCAACACGGTAAGAAGCATCCTCAATGGGATTCCCCAGGATCCT
TTCTTCATGGCGGGCACGGTGAGACTCAACGCCGACCCGCATGGTACTAAGTCAGATGAGGAAATCACGGAGGCC
CTTGTCTCCGTTCATCTTGACCATGTGATTAAGAACAAGGGTGGGCTGGACGTTGAGATGGAGGATGGCCTGTTT
TCACAAGGCGAGAAGCAACTTTTCTGCCTCGCTCGAGCCATCTTGAAAGGCAGCAAGATTGTGGTACTTGATGAA
GCGACAAGCAATATTGATATCAAGACCGAGGGTCTGATCAACAAGGTGATTGAGAGCGAATTTAAAGATGCAACA
GTCGTTACAATCGCGCACCGCCTGAAAGCCATACTAGGCAGCGACCGCATTGCCGTTCTCGAGGCGGGCGAGCTT
GTGGAATTTGACAGTCCCGACGCCTTGCTCAGCCGAGAGTCTCGGCTGAAGCAGTTGTTAGACGGGTATGAGAGG
AGCAATGATGAGCATCCTCCTATACTTGAGAAACATTAG
Transcript >Hirsu2|3748
ATGGCGAGTTTCTGCCCATCCGACCTAGATGACGTCTGGGGACCGGTTGTGAACGAATGCTCTCGGACCTTTGAC
TTCACCCTGCTCTTTGAACAGTCAATACTCTCGACTTTGCCAACGACAATTTTCCTCATTCTCGCCTGGTTGAGG
ATATGGCAGCTCCTGCGCAGGGAACAGAGGCTGGCAACGGGCGTCGTCGCCCTTGCCGAGATTCTGCTGGTCCTG
GGCATGGGAGGATTGCAGTTGGCGCTTGTGGCTCTATGGTCTCGCGATCCCGACACCAGGACCCGGATGTCCATC
GCTATGGCCGTCATCTCTCTGCTTGCCAGTCTGACAATGGCACCGCTTTTCTGGCTTGAGCACACAAGAACCATC
AAGCCGTCTCTTTTGCTCTGCTCCTTCCTAGTTCTCATGACGCTGCTGGAGATGGCGCAGGTCCGCACCTTGTGG
ACGATACGTCGTGCCAACGGAGCCATCGCCTCCTGTTTCACTGCTTCATATGTCATCCGAGCTACACTTCTCGTC
TTCGAAAGCCTTCCGAAGAAGTTGACTCGCGCCGTCGATATCGCACGTAGCCCCGAGGACAAGTGCGGCGCCGTC
TCGCGCAGCTTTTTCCTGTGGCTGATGCCCTTGATATACGCAGGCTTCCGGAGAACACTGGTAGTGGACGACTTG
TACGCGCCACCCATCGACGCAGCGCCTGGTCCTTTGGAGGAGAAGCTTTGGCGAGGATGGAAGAGATCCAAGCCA
GGGTCGAGGAACAGGCTTTTGCTAGTCACCGTCAGGGCCCTGTTGCCGCGTTTACTCACACCTATAGTTCCAAGA
CTCTGCATGGTCGGTTTCATGGCCACGACGCCTATCCTCTTGTCACGTCTGATCCGCTTCCTGGATGACCGTCCC
GAGTCGCCTAACGACGGCTACGGCCTGCTTGGCGCCTACGCTCTTGTTTACATCGGCCTTGCCGTCTCTAATGCC
TGGTACTTTCACCAGACCTTCAAGTTCATCGCCTGTGTTCGAGCCGGACTTGTGGCAATGGTATACAACCGAACC
ATGCAGCTGAGCACAGGGGCTATCGACAAATCGTCAGCCGTGACCGTCATGAGCGCCGACATCGAACGAATTGCC
CTCGGGATCAAGACCATTCACGACATCTGGGCCAACGTTATCCAAGTCGCCTTGGCCGCCTGGCTGCTCGAGAAA
CAGACGGGCGTCGCCATTGTCTTGCCCCTCGTTGTCGCCGCCGCCTGTGGCTACGGGACACTGAAAATCAGCGGA
GCGGCCGGGGGCCAGCAGGCAAACTGGCTTAGCAAGATCGAGAAGCGCATCGAAGTCACCAGCCGGACTTTATCA
TCCATTAGAAGTGTCAAGATAATTGGCCTCGCGCCCAAGTTGACAGACTCGATCCAGCGTCTGAGGGCTACAGAA
CTGCAAGCAGCAGCCAGTTTCCGCTGGTGGCAAGTTGGCGCGCTGATAATGGGGTTTGTGCCCGTCATGATAAAC
CCCGTCCTCACTTTTGCCATCTTCATCGCGGTGGCCCGCGGAAATTCGCAGGCGTTGGACGCCTCGAGGATGTTT
GTCTCATTATCTTTCTTAACCATCATGTCGCAACCGTTGAGCATGCTCTTCCAGTCTGGCCCTCAGATCTCGTCC
ATGATTGCCTGTTTTAATCGAATTGGAAAATTCATCGAGACTCCGGAACGAGAGTTTTCTGTCCAAGATGCTGGC
GAGAAGGATGCCGACGAGATACGAATTTGTGGCGTTAAGTTTGGCTGGTCACCCGAATCGACGCTGGATCTTCGA
AACGTTCACGTTTCGTTCCCTCGTGGCAAACTTACCATGATTATCGGACCTGTCGGATGTGGCAAGTCCACCTTG
CTGAAGAGTCTTCTTGGAGAGGTGCCGCACACCCAAGACTCGGTTGTGAGCATGCCGTCTACAAGCCTCGCGTAT
TGCGATCAGACACCCTGGATTATGAACGGCACGGTCAAGGAAAACATCACCAAGTTTTCTGGTGACGACCCGGAA
TACTATAATACCGTCTTGACTGCCTGCGCTCTGAACAAAGACCTCGCCCAGCTTCCTGACGGCGAAGTGTCCAAA
GTAGGGAGTAAGGGCATTAGCCTCAGCGGCGGCCAAAAGCAACGCCTAGCTCTCGCGCGCGCTCTCTTTGCTCGA
CGGGACATCAATCTGTTCGATGACGTCCTGAGCGGCCTCGATGCCACTACAGGAAATCAGGTTTTCGCGCATGTG
TTCGGGCCGGATGGACTCCTCAAGCGGAATGCATCTACCGTGATCCTCGCAACGCATGCGGTTCATTTCCTCCCG
TATGCAGACCACATCGTGTGCGTCGGGCCCGGTGGAGACATTGTCCAACAGGGGTCCTTCTCTGAGCTGAGTGCG
GCCGATGGCTATGTTCGCAAATTGGATATCGCGAGCATTCAAAGCCTTCCCGAAGTGCACTTCAGTCCCGGCAGC
CCGCCCGATAAGGACACGGAAAGCAAAGCCACGGCGACTACGTATACCGAGCAACATGAGGTTACCCGTGAAGAT
AAGAAGCCCGGGAAGCCACACGGAGCCTTTCGCTACTATATTCGGTCGATTGGATACACAATGGCTGTTCTTTAC
GTCGCACTTGCTGCCACATACGCCTTTCTCTACACGTTTCCGTATATATGGGCCAAGTGGTGGACCGATGCCAAT
GCCAAAGACCCTTGGAACCGCACAGCGTTTTACATTGGCATCTATGCCATGCTACAGGTCCTCTGCCTCGCCTCT
CTTGTTTTATTTGCTTGGCATGCCGTCATCACCATAGTGGTCACGTCCGGTCTCTATCTCCACCATACGCTGTTG
TCAACAACATTGCAGGCCCCTTTGTCCTTCTTTGAGAGAACGGACACGGGCGTCACGCTCAACAGATTCAGTCAG
GACCTGCAGATTGTGGACAATGAGCTTCCTCTGGCCGCTTTGAACATTGCGTGCAGTGGGCTCATTGTCGTCGGT
CAGATGCTCCTCATCATGAACACGTCTTACTGGCTTGCCCTCTCTTTCCCGGCCATCATCCTTATTCTCTGGGCA
TTGCAGAGCGTATATTTGCGCACTTCCAGACAGCTGAGACACCTCGACATCGAAACAAAAGCCCCTCTCTACTCG
CAGTTTGTCGAGTCTCTTGACGGTCTCGTCTGCATCCGCGCCTTTGGGTGGCAGGCGCCACTTAAAGACCTTCTC
TACCATCATCTCGAGCGGTCTCAGCGGCCGTTTTATCTTCTTCTTGTCGTCCAGAGGTGGCTTGGCCTTGTTCTT
GACTGCCTCACGGCTGGGTTTGTCCTTCTGCTTCTCGGAATCGTCATTATTGGCTTGCGTCACCAGGTCAGTCCC
GGTTTTGCCGGTGTCGCCTTGGCAAATCTCATCAATTTGAGTGGTTCCTTGACCACTGTCGTCAATGTTTGGACA
CAGATGGAGACATCCATTGCTTCCATCCAGAGAATTCGTGACTTCGAGAAGAATGTTCCTTCCGAGACCAAGGGA
CTTAGCACCAAGGCAGTACCGTCGGACTGGCCGAGAAAAGGAGCAATTGACATCGAGAATCTAGTCGCAACATAC
AAAGATGGCGAAATTACGGCGCTGAAAAACATAACAATGAGCATCAAGCCTGGCGAGAAGATTGGTGTTTGTGGC
CGGACGGGCAGTGGCAAGACATCCCTGGCCCTTGCACTCTTCCGGATGATTGGCATCGAGGAGGGCTCCATCACG
GTTGACGGTGTTGACATCTCACACGTCGACCCCAACACGGTAAGAAGCATCCTCAATGGGATTCCCCAGGATCCT
TTCTTCATGGCGGGCACGGTGAGACTCAACGCCGACCCGCATGGTACTAAGTCAGATGAGGAAATCACGGAGGCC
CTTGTCTCCGTTCATCTTGACCATGTGATTAAGAACAAGGGTGGGCTGGACGTTGAGATGGAGGATGGCCTGTTT
TCACAAGGCGAGAAGCAACTTTTCTGCCTCGCTCGAGCCATCTTGAAAGGCAGCAAGATTGTGGTACTTGATGAA
GCGACAAGCAATATTGATATCAAGACCGAGGGTCTGATCAACAAGGTGATTGAGAGCGAATTTAAAGATGCAACA
GTCGTTACAATCGCGCACCGCCTGAAAGCCATACTAGGCAGCGACCGCATTGCCGTTCTCGAGGCGGGCGAGCTT
GTGGAATTTGACAGTCCCGACGCCTTGCTCAGCCGAGAGTCTCGGCTGAAGCAGTTGTTAGACGGGTATGAGAGG
AGCAATGATGAGCATCCTCCTATACTTGAGAAACATTAG
Gene >Hirsu2|3748
ATGGCGAGTTTCTGCCCATCCGACCTAGATGACGTCTGGGGACCGGTTGTGAACGAATGCTCTCGGACCTTTGAC
TTCACCCTGCTCTTTGAACAGTCAATACTCTCGACTTTGCCAACGACAATTTTCCTCATTCTCGCCTGGTTGAGG
ATATGGCAGCTCCTGCGCAGGGAACAGAGGCTGGCAACGGGCGTCGTCGCCCTTGCCGAGATTCTGCTGGTCCTG
GGCATGGGAGGATTGCAGTTGGCGCTTGTGGCTCTATGGTCTCGCGATCCCGACACCAGGACCCGGATGTCCATC
GCTATGGCCGTCATCTCTCTGCTTGCCAGTCTGACAATGGCACCGCTTTTCTGGCTTGAGCACACAAGAACCATC
AAGCCGTCTCTTTTGCTCTGCTCCTTCCTAGTTCTCATGACGCTGCTGGAGATGGCGCAGGTCCGCACCTTGTGG
ACGATACGTCGTGCCAACGGAGCCATCGCCTCCTGTTTCACTGCTTCATATGTCATCCGAGCTACACTTCTCGTC
TTCGAAAGCCTTCCGAAGAAGTTGACTCGCGCCGTCGATATCGCACGTAGCCCCGAGGACAAGTGCGGCGCCGTC
TCGCGCAGCTTTTTCCTGTGGCTGATGCCCTTGATATACGCAGGCTTCCGGAGAACACTGGTAGTGGACGACTTG
TACGCGCCACCCATCGACGCAGCGCCTGGTCCTTTGGAGGAGAAGCTTTGGCGAGGATGGAAGAGATGTGAGTGC
CCGTCCCGGATGGGAATCTGCCGACGACATTCTGACAGCGTTTTTCCTGAAGCCAAGCCAGGGTCGAGGAACAGG
CTTTTGCTAGTCACCGTCAGGGCCCTGTTGCCGCGTTTACTCACACCTATAGTTCCAAGACTCTGCATGGTCGGT
TTCATGGCCACGACGCCTATCCTCTTGTCACGTCTGATCCGCTTCCTGGATGACCGTCCCGAGTCGCCTAACGAC
GGCTACGGCCTGCTTGGCGCCTACGCTCTTGTTTACATCGGCCTTGCCGTCTCTAATGCCTGGTACTTTCACCAG
ACCTTCAAGTTCATCGCCTGTGTTCGAGCCGGACTTGTGGCAATGGTATACAACCGAACCATGCAGCTGAGCACA
GGGGCTATCGACAAATCGTCAGCCGTGACCGTCATGAGCGCCGACATCGAACGAATTGCCCTCGGGATCAAGACC
ATTCACGACATCTGGGCCAACGTTATCCAAGTCGCCTTGGCCGCCTGGCTGCTCGAGAAACAGACGGGCGTCGCC
ATTGTCTTGCCCCTCGTTGTCGCCGCCGCCTGTGGCTACGGGACACTGAAAATCAGCGGAGCGGCCGGGGGCCAG
CAGGCAAACTGGCTTAGCAAGATCGAGAAGCGCATCGAAGTCACCAGCCGGACTTTATCATCCATTAGAAGTGTC
AAGATAATTGGCCTCGCGCCCAAGTTGACAGACTCGATCCAGCGTCTGAGGGCTACAGAACTGCAAGCAGCAGCC
AGTTTCCGCTGGTGGCAAGTTGGCGCGCTGATAATGGGGTTTGTGCCCGTCATGATAAACCCCGTCCTCACTTTT
GCCATCTTCATCGCGGTGGCCCGCGGAAATTCGCAGGCGTTGGACGCCTCGAGGATGTTTGTCTCATTATCTTTC
TTAACCATCATGTCGCAACCGTTGAGCATGCTCTTCCAGTCTGGCCCTCAGATCTCGTCCATGATTGCCTGTTTT
AATCGAATTGGAAAATTCATCGAGACTCCGGAACGAGAGTTTTCTGTCCAAGATGCTGGCGAGAAGGATGCCGAC
GAGATACGAATTTGTGGCGTTAAGTTTGGCTGGTCACCCGAATCGACGCTGGATCTTCGAAACGTTCACGTTTCG
TTCCCTCGTGGCAAACTTACCATGATTATCGGACCTGTCGGATGTGGCAAGTCCACCTTGCTGAAGAGTCTTCTT
GGAGAGGTGCCGCACACCCAAGACTCGGTTGTGAGCATGCCGTCTACAAGCCTCGCGTATTGCGATCAGACACCC
TGGATTATGAACGGCACGGTCAAGGAAAACATCACCAAGTTTTCTGGTGACGACCCGGAATACTATAATACCGTC
TTGACTGCCTGCGCTCTGAACAAAGACCTCGCCCAGCTTCCTGACGGCGAAGTGTCCAAAGTAGGGAGTAAGGGC
ATTAGCCTCAGCGGCGGCCAAAAGCAACGCCTAGCTCTCGCGCGCGCTCTCTTTGCTCGACGGGACATCAATCTG
TTCGATGACGTCCTGAGCGGCCTCGATGCCACTACAGGAAATCAGGTTTTCGCGCATGTGTTCGGGCCGGATGGA
CTCCTCAAGCGGAATGCATCTACCGTGATCCTCGCAACGCATGCGGTTCATTTCCTCCCGTATGCAGACCACATC
GTGTGCGTCGGGCCCGGTGGAGACATTGTCCAACAGGGGTCCTTCTCTGAGCTGAGTGCGGCCGATGGCTATGTT
CGCAAATTGGATATCGCGAGCATTCAAAGCCTTCCCGAAGTGCACTTCAGTCCCGGCAGCCCGCCCGATAAGGAC
ACGGAAAGCAAAGCCACGGCGACTACGTATACCGAGCAACATGAGGTTACCCGTGAAGATAAGAAGCCCGGGAAG
CCACACGGAGCCTTTCGCTACTATATTCGGTCGATTGGATACACAATGGCTGTTCTTTACGTCGCACTTGCTGCC
ACATACGCCTTTCTCTACACGTTTCCGTATATATGGGCCAAGTGGTGGACCGATGCCAATGCCAAAGACCCTTGG
AACCGCACAGCGTTTTACATTGGCATCTATGCCATGCTACAGGTCCTCTGCCTCGCCTCTCTTGTTTTATTTGCT
TGGCATGCCGTCATCACCATAGTGGTCACGTCCGGTCTCTATCTCCACCATACGCTGTTGTCAACAACATTGCAG
GCCCCTTTGTCCTTCTTTGAGAGAACGGACACGGGCGTCACGCTCAACAGATTCAGTCAGGACCTGCAGATTGTG
GACAATGAGCTTCCTCTGGCCGCTTTGAACATTGCGTGCAGTGGGCTCATTGTCGTCGGTCAGATGCTCCTCATC
ATGAACACGTCTTACTGGCTTGCCCTCTCTTTCCCGGCCATCATCCTTATTCTCTGGGCATTGCAGAGCGTATAT
TTGCGCACTTCCAGACAGCTGAGACACCTCGACATCGAAACAAAAGCCCCTCTCTACTCGCAGTTTGTCGAGTCT
CTTGACGGTCTCGTCTGCATCCGCGCCTTTGGGTGGCAGGCGCCACTTAAAGACCTTCTCTACCATCATCTCGAG
CGGTCTCAGCGGCCGTTTTATCTTCTTCTTGTCGTCCAGAGGTGGCTTGGCCTTGTTCTTGACTGCCTCACGGCT
GGGTTTGTCCTTCTGCTTCTCGGAATCGTCATTATTGGCTTGCGTCACCAGGTCAGTCCCGGTTTTGCCGGTGTC
GCCTTGGCAAATCTCATCAATTTGAGTGGTTCCTTGACCACTGTCGTCAATGTTTGGACACAGATGGAGACATCC
ATTGCTTCCATCCAGAGAATTCGTGACTTCGAGAAGAATGTTCCTTCCGAGACCAAGGGACTTAGCACCAAGGCA
GTACCGTCGGACTGGCCGAGAAAAGGAGCAATTGACATCGAGAATCTAGTCGCAACATACAAAGATGGCGAAATT
ACGGCGCTGAAAAACATAACAATGAGCATCAAGCCTGGCGAGAAGATTGGTGTTTGTGGCCGGACGGGCAGTGGC
AAGACATCCCTGGCCCTTGCACTCTTCCGGATGATTGGCATCGAGGAGGGCTCCATCACGGTTGACGGTGTTGAC
ATCTCACACGTCGACCCCAACACGGTAAGAAGCATCCTCAATGGGATTCCCCAGGATCCTTTCTTCATGGCGGGC
ACGGTGAGACTCAACGCCGACCCGCATGGTACTAAGTCAGATGAGGAAATCACGGAGGCCCTTGTCTCCGTTCAT
CTTGACCATGTGATTAAGAACAAGGGTGGGCTGGACGTTGAGATGGAGGATGGCCTGTTTTCACAAGGCGAGAAG
CAACTTTTCTGCCTCGCTCGAGCCATCTTGAAAGGCAGCAAGATTGTGGTACTTGATGAAGCGACAAGCAAGTAA
GTTCAGTTTCCCTGGGGAGGAAAGAATTGACAAGACAAACGCTCACACTTTAAAACAGTATTGATATCAAGACCG
AGGGTCTGATCAACAAGGTGATTGAGAGCGAATTTAAAGATGCAACAGTCGTTACAATCGCGCACCGCCTGAAAG
CCATACTAGGCAGCGACCGCATTGCCGTTCTCGAGGCGGGCGAGCTTGTGGAATTTGACAGTCCCGACGCCTTGC
TCAGCCGAGAGTCTCGGCTGAAGCAGTTGTTAGACGGGTATGAGAGGAGCAATGATGAGCATCCTCCTATACTTG
AGAAACATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail