Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3747
Gene name
LocationContig_20:32221..32623
Strand-
Gene length (bp)402
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00857 Isochorismatase Isochorismatase family 1.0E-15 5 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O07081|YRDC_BACSU Uncharacterized isochorismatase family protein YrdC OS=Bacillus subtilis (strain 168) GN=yrdC PE=3 SV=1 2 130 6.0E-19
sp|D4GWH7|Y2328_HALVD Uncharacterized isochorismatase family protein HVO_2328 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=HVO_2328 PE=1 SV=1 4 120 6.0E-15
sp|P96654|YDDQ_BACSU Uncharacterized isochorismatase family protein YddQ OS=Bacillus subtilis (strain 168) GN=yddQ PE=3 SV=1 2 128 1.0E-07

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3747
MEYAAPLPSERIFVKTTNSPFIETDLEKVIKDLHAQRLVVAGLMTAHCVATTLRMAANLRVVDHSYGCPIKNQTH
GSDAEIVLLEDATATFNVGHRGKNYDAETVHAVHLATMKDEFCDVGTTDEVIRSLHEV*
Coding >Hirsu2|3747
ATGGAGTATGCGGCCCCGTTACCGTCCGAGCGCATCTTCGTCAAGACGACAAACTCGCCCTTCATAGAGACAGAC
CTGGAGAAGGTGATCAAGGACCTCCATGCCCAACGCCTCGTTGTAGCGGGCCTGATGACGGCACACTGCGTGGCG
ACAACGCTGCGGATGGCAGCGAATCTACGTGTTGTCGACCACTCCTACGGCTGCCCCATCAAGAACCAAACTCAT
GGCTCAGACGCCGAGATCGTCCTGCTGGAAGATGCCACTGCCACCTTTAATGTCGGCCATCGGGGCAAGAACTAC
GATGCGGAGACTGTGCACGCTGTCCATTTAGCAACCATGAAGGATGAGTTTTGTGATGTGGGGACAACGGATGAG
GTGATTCGATCCTTGCATGAAGTGTAA
Transcript >Hirsu2|3747
ATGGAGTATGCGGCCCCGTTACCGTCCGAGCGCATCTTCGTCAAGACGACAAACTCGCCCTTCATAGAGACAGAC
CTGGAGAAGGTGATCAAGGACCTCCATGCCCAACGCCTCGTTGTAGCGGGCCTGATGACGGCACACTGCGTGGCG
ACAACGCTGCGGATGGCAGCGAATCTACGTGTTGTCGACCACTCCTACGGCTGCCCCATCAAGAACCAAACTCAT
GGCTCAGACGCCGAGATCGTCCTGCTGGAAGATGCCACTGCCACCTTTAATGTCGGCCATCGGGGCAAGAACTAC
GATGCGGAGACTGTGCACGCTGTCCATTTAGCAACCATGAAGGATGAGTTTTGTGATGTGGGGACAACGGATGAG
GTGATTCGATCCTTGCATGAAGTGTAA
Gene >Hirsu2|3747
ATGGAGTATGCGGCCCCGTTACCGTCCGAGCGCATCTTCGTCAAGACGACAAACTCGCCCTTCATAGAGACAGAC
CTGGAGAAGGTGATCAAGGACCTCCATGCCCAACGCCTCGTTGTAGCGGGCCTGATGACGGCACACTGCGTGGCG
ACAACGCTGCGGATGGCAGCGAATCTACGTGTTGTCGACCACTCCTACGGCTGCCCCATCAAGAACCAAACTCAT
GGCTCAGACGCCGAGATCGTCCTGCTGGAAGATGCCACTGCCACCTTTAATGTCGGCCATCGGGGCAAGAACTAC
GATGCGGAGACTGTGCACGCTGTCCATTTAGCAACCATGAAGGATGAGTTTTGTGATGTGGGGACAACGGATGAG
GTGATTCGATCCTTGCATGAAGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail