Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3743
Gene name
LocationContig_20:13367..13604
Strand-
Gene length (bp)237
Transcript length (bp)237
Coding sequence length (bp)237
Protein length (aa) 79

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Signal peptide|Transmembrane domain 0.1908 0.1761 0.4095 0.7127 0.3145 0.0852 0.4519 0.5604 0.341 0.0434

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 10 29 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7573
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|3743 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3743
MGAIGAVIKFVIIPIAIVVLLGFAVVLVWQHKKRSKDVEKAEPLPPVNMNYAQPPAYIVGPDNFKPPAGVGQTTH
PVN*
Coding >Hirsu2|3743
ATGGGAGCCATAGGAGCCGTGATCAAGTTCGTCATCATACCGATTGCAATCGTCGTCTTATTAGGATTCGCCGTC
GTCCTTGTTTGGCAGCACAAAAAGCGAAGCAAGGACGTCGAGAAAGCCGAGCCTTTACCACCTGTCAACATGAAC
TACGCCCAGCCGCCGGCATATATAGTCGGACCAGACAACTTCAAACCACCTGCCGGGGTTGGCCAAACGACGCAT
CCGGTCAACTGA
Transcript >Hirsu2|3743
ATGGGAGCCATAGGAGCCGTGATCAAGTTCGTCATCATACCGATTGCAATCGTCGTCTTATTAGGATTCGCCGTC
GTCCTTGTTTGGCAGCACAAAAAGCGAAGCAAGGACGTCGAGAAAGCCGAGCCTTTACCACCTGTCAACATGAAC
TACGCCCAGCCGCCGGCATATATAGTCGGACCAGACAACTTCAAACCACCTGCCGGGGTTGGCCAAACGACGCAT
CCGGTCAACTGA
Gene >Hirsu2|3743
ATGGGAGCCATAGGAGCCGTGATCAAGTTCGTCATCATACCGATTGCAATCGTCGTCTTATTAGGATTCGCCGTC
GTCCTTGTTTGGCAGCACAAAAAGCGAAGCAAGGACGTCGAGAAAGCCGAGCCTTTACCACCTGTCAACATGAAC
TACGCCCAGCCGCCGGCATATATAGTCGGACCAGACAACTTCAAACCACCTGCCGGGGTTGGCCAAACGACGCAT
CCGGTCAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail