Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|374
Gene name
LocationContig_1070:9024..9303
Strand+
Gene length (bp)279
Transcript length (bp)279
Coding sequence length (bp)279
Protein length (aa) 93

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 3.6E-07 21 85
PF00890 FAD_binding_2 FAD binding domain 2.2E-06 21 57
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 8.2E-06 23 53
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.0E-04 20 67
PF04820 Trp_halogenase Tryptophan halogenase 1.2E-04 20 88

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 20 77 8.0E-09
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 19 75 7.0E-06
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 19 75 7.0E-06
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 43 80 7.0E-06

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0050662 coenzyme binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|374
MDPDGEGRFFANRRAARPLRIVVVGAGIAGLTAGLGLKMTGHDVTILEQAAHFREAGAGIQIAPNAARVLDRFGV
LEEVLRDADVLERVSVR*
Coding >Hirsu2|374
ATGGATCCCGACGGCGAGGGGCGCTTCTTCGCCAACCGGCGCGCGGCCCGGCCGCTGCGCATCGTCGTCGTCGGC
GCCGGCATCGCCGGCCTCACTGCCGGCCTCGGCCTCAAGATGACGGGCCACGACGTCACCATCCTCGAGCAGGCC
GCCCACTTCCGCGAGGCCGGCGCCGGCATCCAGATCGCGCCCAACGCCGCCCGCGTCCTCGACCGCTTCGGCGTC
CTGGAGGAGGTCCTGCGCGACGCCGACGTCCTGGAGCGGGTGTCCGTGAGGTAG
Transcript >Hirsu2|374
ATGGATCCCGACGGCGAGGGGCGCTTCTTCGCCAACCGGCGCGCGGCCCGGCCGCTGCGCATCGTCGTCGTCGGC
GCCGGCATCGCCGGCCTCACTGCCGGCCTCGGCCTCAAGATGACGGGCCACGACGTCACCATCCTCGAGCAGGCC
GCCCACTTCCGCGAGGCCGGCGCCGGCATCCAGATCGCGCCCAACGCCGCCCGCGTCCTCGACCGCTTCGGCGTC
CTGGAGGAGGTCCTGCGCGACGCCGACGTCCTGGAGCGGGTGTCCGTGAGGTAG
Gene >Hirsu2|374
ATGGATCCCGACGGCGAGGGGCGCTTCTTCGCCAACCGGCGCGCGGCCCGGCCGCTGCGCATCGTCGTCGTCGGC
GCCGGCATCGCCGGCCTCACTGCCGGCCTCGGCCTCAAGATGACGGGCCACGACGTCACCATCCTCGAGCAGGCC
GCCCACTTCCGCGAGGCCGGCGCCGGCATCCAGATCGCGCCCAACGCCGCCCGCGTCCTCGACCGCTTCGGCGTC
CTGGAGGAGGTCCTGCGCGACGCCGACGTCCTGGAGCGGGTGTCCGTGAGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail