Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3739
Gene name
LocationContig_20:1161..2397
Strand-
Gene length (bp)1236
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 1.0E-22 77 368
PF07969 Amidohydro_3 Amidohydrolase family 1.1E-08 267 352

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|B2KCN5|PYRC_ELUMP Dihydroorotase OS=Elusimicrobium minutum (strain Pei191) GN=pyrC PE=3 SV=1 26 88 3.0E-06

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3739
MHRRTTFKALCFMFFSLSHTTQAASFTISNANIIDVNSGKIQKKQNILIQDDKIASIESAQQGQAQGDNVVDVKG
QFVMPGFSDMHTHPYFTNDAKQFPTTDNSTFKEYLASGVTFIRDCGSNFDAVKSAQSRIAAKQLLGPRIASVGPM
LDGKDTGFQTVEKIGSAQEANSVVSDLTSQGADYIKVHLKLTADAFGAIATACQQNNISFGGHVPDQINARTAVQ
KGMRIFEHMSRIESDNDVALLRGNEFTATCTLVQGPTPQRMKTCAGLQKGQTRVLSGTDSPAGQGLCPGRSLHRE
LELMNQAGLSPLEVLQSTTIRAAEAVNMENEIGTVEVGKFADLVILTKNPLEDIKNTRNVAGVVANGTYLSAQDI
QKLRSAANVAKTLPFACGDSKAQKLAARTAVTCCSA*
Coding >Hirsu2|3739
ATGCATCGACGAACGACCTTCAAGGCGCTATGCTTCATGTTTTTCTCCTTATCACATACCACACAAGCCGCGTCG
TTCACGATTTCCAACGCCAATATTATTGATGTGAACTCCGGTAAAATTCAAAAGAAGCAGAACATTCTTATCCAG
GATGATAAGATCGCGAGTATTGAGAGTGCACAGCAAGGGCAGGCGCAGGGCGATAACGTCGTTGATGTTAAAGGC
CAGTTTGTTATGCCGGGCTTCAGCGACATGCACACTCACCCCTACTTCACGAACGATGCCAAGCAATTTCCGACA
ACGGACAATTCGACATTCAAGGAGTATCTTGCCAGCGGCGTCACATTTATACGCGATTGCGGCAGCAACTTTGAC
GCCGTCAAGTCGGCACAAAGCAGAATCGCCGCGAAACAACTCCTGGGACCGCGTATCGCCTCGGTGGGCCCAATG
CTCGACGGCAAAGACACGGGCTTCCAGACGGTGGAGAAAATAGGAAGCGCCCAAGAAGCTAATAGCGTAGTGAGC
GACCTCACGAGCCAAGGTGCCGACTATATTAAGGTACACCTGAAATTGACGGCGGATGCGTTTGGCGCGATAGCA
ACAGCATGCCAACAGAACAATATATCCTTCGGAGGACACGTGCCCGACCAGATTAACGCAAGAACAGCCGTGCAG
AAGGGTATGAGAATTTTTGAGCACATGAGTCGCATTGAAAGCGATAATGATGTCGCCCTTCTGAGAGGCAACGAG
TTTACGGCTACTTGTACGCTTGTGCAAGGGCCGACACCACAGCGCATGAAGACTTGTGCCGGTCTGCAAAAGGGA
CAGACCCGAGTACTCTCGGGCACAGATTCGCCGGCGGGCCAAGGCCTCTGTCCGGGTAGAAGCCTCCACCGGGAA
TTAGAGCTTATGAATCAGGCCGGCCTCTCCCCGTTAGAAGTGCTCCAGTCCACGACAATCAGGGCAGCCGAGGCG
GTTAACATGGAGAATGAAATAGGAACAGTCGAGGTCGGAAAGTTCGCCGATCTGGTAATTCTAACGAAGAATCCG
CTCGAAGATATCAAAAATACCCGCAACGTCGCTGGCGTCGTTGCCAATGGGACTTATTTGTCGGCTCAGGATATA
CAAAAACTGCGCAGTGCAGCCAATGTCGCCAAGACACTACCATTTGCGTGTGGCGACTCGAAAGCTCAGAAACTT
GCAGCAAGAACTGCAGTAACGTGTTGTTCGGCATAG
Transcript >Hirsu2|3739
ATGCATCGACGAACGACCTTCAAGGCGCTATGCTTCATGTTTTTCTCCTTATCACATACCACACAAGCCGCGTCG
TTCACGATTTCCAACGCCAATATTATTGATGTGAACTCCGGTAAAATTCAAAAGAAGCAGAACATTCTTATCCAG
GATGATAAGATCGCGAGTATTGAGAGTGCACAGCAAGGGCAGGCGCAGGGCGATAACGTCGTTGATGTTAAAGGC
CAGTTTGTTATGCCGGGCTTCAGCGACATGCACACTCACCCCTACTTCACGAACGATGCCAAGCAATTTCCGACA
ACGGACAATTCGACATTCAAGGAGTATCTTGCCAGCGGCGTCACATTTATACGCGATTGCGGCAGCAACTTTGAC
GCCGTCAAGTCGGCACAAAGCAGAATCGCCGCGAAACAACTCCTGGGACCGCGTATCGCCTCGGTGGGCCCAATG
CTCGACGGCAAAGACACGGGCTTCCAGACGGTGGAGAAAATAGGAAGCGCCCAAGAAGCTAATAGCGTAGTGAGC
GACCTCACGAGCCAAGGTGCCGACTATATTAAGGTACACCTGAAATTGACGGCGGATGCGTTTGGCGCGATAGCA
ACAGCATGCCAACAGAACAATATATCCTTCGGAGGACACGTGCCCGACCAGATTAACGCAAGAACAGCCGTGCAG
AAGGGTATGAGAATTTTTGAGCACATGAGTCGCATTGAAAGCGATAATGATGTCGCCCTTCTGAGAGGCAACGAG
TTTACGGCTACTTGTACGCTTGTGCAAGGGCCGACACCACAGCGCATGAAGACTTGTGCCGGTCTGCAAAAGGGA
CAGACCCGAGTACTCTCGGGCACAGATTCGCCGGCGGGCCAAGGCCTCTGTCCGGGTAGAAGCCTCCACCGGGAA
TTAGAGCTTATGAATCAGGCCGGCCTCTCCCCGTTAGAAGTGCTCCAGTCCACGACAATCAGGGCAGCCGAGGCG
GTTAACATGGAGAATGAAATAGGAACAGTCGAGGTCGGAAAGTTCGCCGATCTGGTAATTCTAACGAAGAATCCG
CTCGAAGATATCAAAAATACCCGCAACGTCGCTGGCGTCGTTGCCAATGGGACTTATTTGTCGGCTCAGGATATA
CAAAAACTGCGCAGTGCAGCCAATGTCGCCAAGACACTACCATTTGCGTGTGGCGACTCGAAAGCTCAGAAACTT
GCAGCAAGAACTGCAGTAACGTGTTGTTCGGCATAG
Gene >Hirsu2|3739
ATGCATCGACGAACGACCTTCAAGGCGCTATGCTTCATGTTTTTCTCCTTATCACATACCACACAAGCCGCGTCG
TTCACGATTTCCAACGCCAATATTATTGATGTGAACTCCGGTAAAATTCAAAAGAAGCAGAACATTCTTATCCAG
GATGATAAGATCGCGAGTATTGAGAGTGCACAGCAAGGGCAGGCGCAGGGCGATAACGTCGTTGATGTTAAAGGC
CAGTTTGTTATGCCGGGCTTCAGCGACATGCACACTCACCCCTACTTCACGAACGATGCCAAGCAATTTCCGACA
ACGGACAATTCGACATTCAAGGAGTATCTTGCCAGCGGCGTCACATTTATACGCGATTGCGGCAGCAACTTTGAC
GCCGTCAAGTCGGCACAAAGCAGAATCGCCGCGAAACAACTCCTGGGACCGCGTATCGCCTCGGTGGGCCCAATG
CTCGACGGCAAAGACACGGGCTTCCAGACGGTGGAGAAAATAGGAAGCGCCCAAGAAGCTAATAGCGTAGTGAGC
GACCTCACGAGCCAAGGTGCCGACTATATTAAGGTACACCTGAAATTGACGGCGGATGCGTTTGGCGCGATAGCA
ACAGCATGCCAACAGAACAATATATCCTTCGGAGGACACGTGCCCGACCAGATTAACGCAAGAACAGCCGTGCAG
AAGGGTATGAGAATTTTTGAGCACATGAGTCGCATTGAAAGCGATAATGATGTCGCCCTTCTGAGAGGCAACGAG
TTTACGGCTACTTGTACGCTTGTGCAAGGGCCGACACCACAGCGCATGAAGACTTGTGCCGGTCTGCAAAAGGGA
CAGACCCGAGTACTCTCGGGCACAGATTCGCCGGCGGGCCAAGGCCTCTGTCCGGGTAGAAGCCTCCACCGGGAA
TTAGAGCTTATGAATCAGGCCGGCCTCTCCCCGTTAGAAGTGCTCCAGTCCACGACAATCAGGGCAGCCGAGGCG
GTTAACATGGAGAATGAAATAGGAACAGTCGAGGTCGGAAAGTTCGCCGATCTGGTAATTCTAACGAAGAATCCG
CTCGAAGATATCAAAAATACCCGCAACGTCGCTGGCGTCGTTGCCAATGGGACTTATTTGTCGGCTCAGGATATA
CAAAAACTGCGCAGTGCAGCCAATGTCGCCAAGACACTACCATTTGCGTGTGGCGACTCGAAAGCTCAGAAACTT
GCAGCAAGAACTGCAGTAACGTGTTGTTCGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail