Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3731
Gene name
LocationContig_2:82785..83970
Strand-
Gene length (bp)1185
Transcript length (bp)891
Coding sequence length (bp)891
Protein length (aa) 297

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase 1.9E-34 39 226

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4VK43|TAL_PSEU5 Transaldolase OS=Pseudomonas stutzeri (strain A1501) GN=tal PE=3 SV=1 43 294 1.0E-22
sp|B4RX40|TAL_ALTMD Transaldolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tal PE=3 SV=1 44 295 7.0E-22
sp|C5CPN2|TAL_VARPS Transaldolase OS=Variovorax paradoxus (strain S110) GN=tal PE=3 SV=1 40 294 1.0E-21
sp|Q4KF90|TAL_PSEF5 Transaldolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tal PE=3 SV=1 43 292 2.0E-21
sp|B1Y2Y8|TAL_LEPCP Transaldolase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=tal PE=3 SV=1 40 292 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4VK43|TAL_PSEU5 Transaldolase OS=Pseudomonas stutzeri (strain A1501) GN=tal PE=3 SV=1 43 294 1.0E-22
sp|B4RX40|TAL_ALTMD Transaldolase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tal PE=3 SV=1 44 295 7.0E-22
sp|C5CPN2|TAL_VARPS Transaldolase OS=Variovorax paradoxus (strain S110) GN=tal PE=3 SV=1 40 294 1.0E-21
sp|Q4KF90|TAL_PSEF5 Transaldolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tal PE=3 SV=1 43 292 2.0E-21
sp|B1Y2Y8|TAL_LEPCP Transaldolase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=tal PE=3 SV=1 40 292 2.0E-21
sp|Q48KH5|TAL_PSE14 Transaldolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tal PE=3 SV=1 43 292 4.0E-21
sp|Q9I047|TAL_PSEAE Transaldolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tal PE=3 SV=1 43 292 5.0E-21
sp|Q02NV3|TAL_PSEAB Transaldolase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tal PE=3 SV=1 43 292 5.0E-21
sp|A3D1F5|TAL_SHEB5 Transaldolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tal PE=3 SV=1 44 292 5.0E-21
sp|B7UWP0|TAL_PSEA8 Transaldolase OS=Pseudomonas aeruginosa (strain LESB58) GN=tal PE=3 SV=1 43 292 6.0E-21
sp|O42700|TAL1_SCHPO Transaldolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tal1 PE=1 SV=2 42 263 6.0E-21
sp|A9L4T6|TAL_SHEB9 Transaldolase OS=Shewanella baltica (strain OS195) GN=tal PE=3 SV=1 44 292 7.0E-21
sp|Q4ZV64|TAL_PSEU2 Transaldolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tal PE=3 SV=1 43 296 8.0E-21
sp|J9MJK9|TAL1_FUSO4 Transaldolase OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) GN=FOXG_03074 PE=1 SV=1 44 295 1.0E-20
sp|A0L002|TAL_SHESA Transaldolase OS=Shewanella sp. (strain ANA-3) GN=tal PE=3 SV=1 42 293 1.0E-20
sp|B8EFD7|TAL_SHEB2 Transaldolase OS=Shewanella baltica (strain OS223) GN=tal PE=3 SV=1 44 292 1.0E-20
sp|A6WKC4|TAL_SHEB8 Transaldolase OS=Shewanella baltica (strain OS185) GN=tal PE=3 SV=1 44 292 2.0E-20
sp|A1RMN6|TAL_SHESW Transaldolase OS=Shewanella sp. (strain W3-18-1) GN=tal PE=3 SV=1 42 293 2.0E-20
sp|A4Y494|TAL_SHEPC Transaldolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tal PE=3 SV=1 42 293 2.0E-20
sp|Q0HFX9|TAL_SHESM Transaldolase OS=Shewanella sp. (strain MR-4) GN=tal PE=3 SV=1 42 293 2.0E-20
sp|B2U9W5|TAL_RALPJ Transaldolase OS=Ralstonia pickettii (strain 12J) GN=tal PE=3 SV=1 45 296 2.0E-20
sp|Q0HS72|TAL_SHESR Transaldolase OS=Shewanella sp. (strain MR-7) GN=tal PE=3 SV=1 42 293 3.0E-20
sp|Q884H4|TAL_PSESM Transaldolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tal PE=3 SV=1 43 296 4.0E-20
sp|Q9PK80|TAL_CHLMU Transaldolase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tal PE=3 SV=1 37 221 4.0E-20
sp|P53228|TAL2_YEAST Transaldolase NQM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NQM1 PE=1 SV=1 42 259 5.0E-20
sp|Q326L3|TAL_SHIBS Transaldolase OS=Shigella boydii serotype 4 (strain Sb227) GN=tal PE=3 SV=1 44 292 1.0E-19
sp|K0BE10|TAL_ECO1E Transaldolase OS=Escherichia coli O104:H4 (strain 2009EL-2071) GN=tal PE=1 SV=1 44 292 1.0E-19
sp|Q8EBH2|TAL_SHEON Transaldolase OS=Shewanella oneidensis (strain MR-1) GN=tal PE=3 SV=1 42 293 1.0E-19
sp|P0A872|TALB_SHIFL Transaldolase B OS=Shigella flexneri GN=talB PE=3 SV=2 44 292 2.0E-19
sp|P0A870|TALB_ECOLI Transaldolase B OS=Escherichia coli (strain K12) GN=talB PE=1 SV=2 44 292 2.0E-19
sp|P0A871|TALB_ECO57 Transaldolase B OS=Escherichia coli O157:H7 GN=talB PE=3 SV=2 44 292 2.0E-19
sp|Q3Z606|TAL1_SHISS Transaldolase 1 OS=Shigella sonnei (strain Ss046) GN=tal1 PE=3 SV=1 44 292 2.0E-19
sp|Q32KB0|TAL_SHIDS Transaldolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tal PE=3 SV=1 44 292 2.0E-19
sp|Q8FLD1|TALB_ECOL6 Transaldolase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=talB PE=3 SV=3 44 292 2.0E-19
sp|B1J623|TAL_PSEPW Transaldolase OS=Pseudomonas putida (strain W619) GN=tal PE=3 SV=1 9 292 2.0E-19
sp|A1S414|TAL_SHEAM Transaldolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tal PE=3 SV=1 42 293 3.0E-19
sp|Q8Y014|TAL_RALSO Transaldolase OS=Ralstonia solanacearum (strain GMI1000) GN=tal PE=3 SV=1 45 292 3.0E-19
sp|Q31C15|TAL_PROM9 Transaldolase OS=Prochlorococcus marinus (strain MIT 9312) GN=tal PE=1 SV=1 34 221 4.0E-19
sp|Q3K9H0|TAL_PSEPF Transaldolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tal PE=3 SV=1 43 293 4.0E-19
sp|Q66ET5|TAL_YERPS Transaldolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tal PE=3 SV=1 44 292 4.0E-19
sp|B2K3L5|TAL_YERPB Transaldolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tal PE=3 SV=1 44 292 4.0E-19
sp|B1JL09|TAL_YERPY Transaldolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tal PE=3 SV=1 44 292 5.0E-19
sp|A9R021|TAL_YERPG Transaldolase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tal PE=3 SV=1 44 292 5.0E-19
sp|Q8ZIN2|TAL_YERPE Transaldolase OS=Yersinia pestis GN=tal PE=3 SV=1 44 292 5.0E-19
sp|A7FME9|TAL_YERP3 Transaldolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tal PE=3 SV=1 44 292 5.0E-19
sp|A3QBW2|TAL_SHELP Transaldolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tal PE=3 SV=1 42 293 6.0E-19
sp|Q7VY99|TAL_BORPE Transaldolase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tal PE=3 SV=1 39 295 6.0E-19
sp|Q3KM49|TAL_CHLTA Transaldolase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tal PE=3 SV=1 37 221 7.0E-19
sp|P66955|TALB_SALTY Transaldolase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=talB PE=3 SV=2 44 292 7.0E-19
sp|P66956|TALB_SALTI Transaldolase B OS=Salmonella typhi GN=talB PE=3 SV=2 44 292 7.0E-19
sp|Q5PDM6|TAL1_SALPA Transaldolase 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tal1 PE=3 SV=1 44 292 7.0E-19
sp|Q57TP8|TAL1_SALCH Transaldolase 1 OS=Salmonella choleraesuis (strain SC-B67) GN=tal1 PE=3 SV=2 44 292 7.0E-19
sp|O84315|TAL_CHLTR Transaldolase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tal PE=3 SV=1 37 221 7.0E-19
sp|A8FSH3|TAL_SHESH Transaldolase OS=Shewanella sediminis (strain HAW-EB3) GN=tal PE=3 SV=1 42 222 8.0E-19
sp|A1JJD0|TAL_YERE8 Transaldolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tal PE=3 SV=1 44 292 8.0E-19
sp|A3PBP3|TAL_PROM0 Transaldolase OS=Prochlorococcus marinus (strain MIT 9301) GN=tal PE=3 SV=1 20 221 1.0E-18
sp|Q1H0R4|TAL_METFK Transaldolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tal PE=3 SV=1 42 295 1.0E-18
sp|Q46ZK0|TAL_CUPPJ Transaldolase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tal PE=3 SV=2 60 292 1.0E-18
sp|Q15PR4|TAL_PSEA6 Transaldolase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tal PE=3 SV=1 51 295 1.0E-18
sp|B0KHA7|TAL_PSEPG Transaldolase OS=Pseudomonas putida (strain GB-1) GN=tal PE=3 SV=1 42 295 1.0E-18
sp|Q88KX1|TAL_PSEPK Transaldolase OS=Pseudomonas putida (strain KT2440) GN=tal PE=3 SV=1 42 292 1.0E-18
sp|Q7WAY2|TAL_BORPA Transaldolase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tal PE=3 SV=1 39 295 2.0E-18
sp|Q7WME6|TAL_BORBR Transaldolase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tal PE=3 SV=2 39 295 2.0E-18
sp|Q07Z25|TAL_SHEFN Transaldolase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tal PE=3 SV=1 42 293 2.0E-18
sp|Q12KL3|TAL_SHEDO Transaldolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tal PE=3 SV=1 42 293 2.0E-18
sp|Q7U5E8|TAL_SYNPX Transaldolase OS=Synechococcus sp. (strain WH8102) GN=tal PE=3 SV=1 18 296 3.0E-18
sp|B4F2V2|TAL_PROMH Transaldolase OS=Proteus mirabilis (strain HI4320) GN=tal PE=3 SV=1 44 292 3.0E-18
sp|B3PDM9|TAL_CELJU Transaldolase OS=Cellvibrio japonicus (strain Ueda107) GN=tal PE=3 SV=1 18 295 3.0E-18
sp|B0TJA0|TAL_SHEHH Transaldolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tal PE=3 SV=1 42 295 3.0E-18
sp|A6VYA4|TAL_MARMS Transaldolase OS=Marinomonas sp. (strain MWYL1) GN=tal PE=3 SV=1 41 293 3.0E-18
sp|B1YU93|TAL_BURA4 Transaldolase OS=Burkholderia ambifaria (strain MC40-6) GN=tal PE=3 SV=1 40 296 4.0E-18
sp|Q8PCA4|TAL_XANCP Transaldolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tal PE=3 SV=1 46 219 4.0E-18
sp|B0RUE4|TAL_XANCB Transaldolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tal PE=3 SV=1 46 219 4.0E-18
sp|Q4UR79|TAL_XANC8 Transaldolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tal PE=3 SV=1 46 219 4.0E-18
sp|B8CSD3|TAL_SHEPW Transaldolase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=tal PE=3 SV=1 42 293 6.0E-18
sp|Q7VD64|TAL_PROMA Transaldolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tal PE=3 SV=1 44 219 8.0E-18
sp|Q5N127|TAL_SYNP6 Transaldolase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tal PE=3 SV=1 44 222 8.0E-18
sp|B1KIS4|TAL_SHEWM Transaldolase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tal PE=3 SV=1 42 295 9.0E-18
sp|A1U1Y1|TAL_MARHV Transaldolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tal PE=3 SV=1 34 294 9.0E-18
sp|A1WIS6|TAL_VEREI Transaldolase OS=Verminephrobacter eiseniae (strain EF01-2) GN=tal PE=3 SV=1 45 292 9.0E-18
sp|Q8PNY6|TAL_XANAC Transaldolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tal PE=3 SV=1 46 219 1.0E-17
sp|Q3BX43|TAL_XANC5 Transaldolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tal PE=3 SV=1 46 219 1.0E-17
sp|Q9S0X4|TAL_METAM Transaldolase OS=Methylomonas aminofaciens GN=tal PE=3 SV=1 42 217 1.0E-17
sp|A9HYZ1|TAL_BORPD Transaldolase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=tal PE=3 SV=1 46 292 1.0E-17
sp|A4XTM7|TAL_PSEMY Transaldolase OS=Pseudomonas mendocina (strain ymp) GN=tal PE=3 SV=1 43 292 2.0E-17
sp|Q8DLL7|TAL_THEEB Transaldolase OS=Thermosynechococcus elongatus (strain BP-1) GN=tal PE=3 SV=1 43 222 3.0E-17
sp|Q1LU10|TAL_BAUCH Transaldolase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tal PE=3 SV=1 44 219 3.0E-17
sp|Q7NK81|TAL_GLOVI Transaldolase OS=Gloeobacter violaceus (strain PCC 7421) GN=tal PE=3 SV=1 46 222 3.0E-17
sp|A1TKQ3|TAL_ACIAC Transaldolase OS=Acidovorax citrulli (strain AAC00-1) GN=tal PE=3 SV=1 45 292 3.0E-17
sp|A8H1G4|TAL_SHEPA Transaldolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tal PE=3 SV=1 42 219 3.0E-17
sp|A2SKF9|TAL_METPP Transaldolase OS=Methylibium petroleiphilum (strain PM1) GN=tal PE=3 SV=1 40 219 3.0E-17
sp|Q7N8Z1|TAL_PHOLL Transaldolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tal PE=3 SV=1 44 240 3.0E-17
sp|Q1I7G7|TAL_PSEE4 Transaldolase OS=Pseudomonas entomophila (strain L48) GN=tal PE=3 SV=1 42 292 4.0E-17
sp|Q54UP4|TALDO_DICDI Probable transaldolase OS=Dictyostelium discoideum GN=tal PE=3 SV=1 34 240 4.0E-17
sp|Q0BD43|TAL_BURCM Transaldolase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tal PE=3 SV=1 42 296 5.0E-17
sp|A6V3U3|TAL_PSEA7 Transaldolase OS=Pseudomonas aeruginosa (strain PA7) GN=tal PE=3 SV=1 43 292 6.0E-17
sp|A4SK74|TAL_AERS4 Transaldolase OS=Aeromonas salmonicida (strain A449) GN=tal PE=3 SV=1 46 292 8.0E-17
sp|B2J2D9|TAL_NOSP7 Transaldolase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tal PE=3 SV=1 43 222 9.0E-17
sp|P34214|TAL1_KLULA Transaldolase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TAL1 PE=3 SV=3 42 282 1.0E-16
sp|Q6D8W0|TAL1_PECAS Transaldolase 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tal1 PE=3 SV=1 44 292 2.0E-16
sp|Q2KVT3|TAL_BORA1 Transaldolase OS=Bordetella avium (strain 197N) GN=tal PE=3 SV=1 46 293 2.0E-16
sp|C5BLR8|TAL_TERTT Transaldolase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tal PE=3 SV=1 42 293 3.0E-16
sp|C5B7L0|TAL_EDWI9 Transaldolase OS=Edwardsiella ictaluri (strain 93-146) GN=tal PE=3 SV=1 44 229 3.0E-16
sp|B3R1I4|TAL_CUPTR Transaldolase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=tal PE=3 SV=1 45 220 4.0E-16
sp|Q8U7I5|TAL_AGRFC Transaldolase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tal PE=3 SV=1 46 295 5.0E-16
sp|Q9CKL0|TALA_PASMU Transaldolase A OS=Pasteurella multocida (strain Pm70) GN=talA PE=3 SV=1 19 292 6.0E-16
sp|Q058B4|TAL_BUCCC Transaldolase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=tal PE=3 SV=1 44 220 6.0E-16
sp|Q8Z4T0|TALA_SALTI Transaldolase A OS=Salmonella typhi GN=talA PE=3 SV=1 44 214 7.0E-16
sp|Q57LN7|TAL2_SALCH Transaldolase 2 OS=Salmonella choleraesuis (strain SC-B67) GN=tal2 PE=3 SV=1 44 214 7.0E-16
sp|Q8D1X3|TAL_WIGBR Transaldolase OS=Wigglesworthia glossinidia brevipalpis GN=tal PE=3 SV=1 44 214 8.0E-16
sp|A4JGM1|TAL_BURVG Transaldolase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tal PE=3 SV=1 42 292 9.0E-16
sp|Q5PCU4|TAL2_SALPA Transaldolase 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tal2 PE=3 SV=1 44 214 1.0E-15
sp|Q8ZN83|TALA_SALTY Transaldolase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=talA PE=3 SV=1 44 214 1.0E-15
sp|Q83QM8|TALA_SHIFL Transaldolase A OS=Shigella flexneri GN=talA PE=3 SV=1 44 219 1.0E-15
sp|Q0K979|TAL_CUPNH Transaldolase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tal PE=3 SV=1 45 292 1.0E-15
sp|P72797|TAL_SYNY3 Transaldolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tal PE=3 SV=1 43 222 1.0E-15
sp|Q3YZ89|TAL2_SHISS Transaldolase 2 OS=Shigella sonnei (strain Ss046) GN=tal2 PE=3 SV=1 44 219 1.0E-15
sp|P0A867|TALA_ECOLI Transaldolase A OS=Escherichia coli (strain K12) GN=talA PE=3 SV=1 44 219 1.0E-15
sp|P0A868|TALA_ECOL6 Transaldolase A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=talA PE=3 SV=1 44 219 1.0E-15
sp|P0A869|TALA_ECO57 Transaldolase A OS=Escherichia coli O157:H7 GN=talA PE=3 SV=1 44 219 1.0E-15
sp|Q2NZS1|TAL_XANOM Transaldolase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tal PE=3 SV=1 46 219 1.0E-15
sp|B2SQJ4|TAL_XANOP Transaldolase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=tal PE=3 SV=1 46 219 1.0E-15
sp|Q5GWL8|TAL_XANOR Transaldolase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tal PE=3 SV=1 46 219 1.0E-15
sp|B5ZQY2|TAL_RHILW Transaldolase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=tal PE=3 SV=1 34 221 1.0E-15
sp|A5F028|TAL_VIBC3 Transaldolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tal PE=3 SV=1 46 292 2.0E-15
sp|B8F5Q3|TAL_HAEPS Transaldolase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=tal PE=3 SV=1 44 292 2.0E-15
sp|B3GZQ2|TAL_ACTP7 Transaldolase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=tal PE=3 SV=1 44 224 2.0E-15
sp|Q2SZY3|TAL_BURTA Transaldolase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tal PE=3 SV=1 45 292 2.0E-15
sp|Q6D0B2|TAL2_PECAS Transaldolase 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tal2 PE=3 SV=1 44 222 2.0E-15
sp|C3LVN8|TAL_VIBCM Transaldolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tal PE=3 SV=1 46 292 2.0E-15
sp|Q9KLW8|TAL_VIBCH Transaldolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tal PE=3 SV=1 46 292 2.0E-15
sp|A0K9A9|TAL_BURCH Transaldolase OS=Burkholderia cenocepacia (strain HI2424) GN=tal PE=3 SV=1 42 292 2.0E-15
sp|Q1BUS8|TAL_BURCA Transaldolase OS=Burkholderia cenocepacia (strain AU 1054) GN=tal PE=3 SV=1 42 292 2.0E-15
sp|Q2K414|TAL_RHIEC Transaldolase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tal PE=3 SV=1 34 221 3.0E-15
sp|P37837|TALDO_HUMAN Transaldolase OS=Homo sapiens GN=TALDO1 PE=1 SV=2 44 213 3.0E-15
sp|Q9EQS0|TALDO_RAT Transaldolase OS=Rattus norvegicus GN=Taldo1 PE=1 SV=2 18 221 3.0E-15
sp|Q2TBL6|TALDO_BOVIN Transaldolase OS=Bos taurus GN=TALDO1 PE=2 SV=1 44 221 4.0E-15
sp|Q7V6B8|TAL_PROMM Transaldolase OS=Prochlorococcus marinus (strain MIT 9313) GN=tal PE=3 SV=1 44 222 4.0E-15
sp|Q12FI4|TAL_POLSJ Transaldolase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tal PE=3 SV=1 45 292 4.0E-15
sp|Q65PZ8|TAL_MANSM Transaldolase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tal PE=3 SV=1 44 224 5.0E-15
sp|A9BXM7|TAL_DELAS Transaldolase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=tal PE=3 SV=1 45 294 6.0E-15
sp|A9BEE2|TAL_PROM4 Transaldolase OS=Prochlorococcus marinus (strain MIT 9211) GN=tal PE=3 SV=1 18 229 6.0E-15
sp|B0BRM0|TAL_ACTPJ Transaldolase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tal PE=3 SV=1 44 224 6.0E-15
sp|Q93092|TALDO_MOUSE Transaldolase OS=Mus musculus GN=Taldo1 PE=1 SV=2 18 221 6.0E-15
sp|B1JW82|TAL_BURCC Transaldolase OS=Burkholderia cenocepacia (strain MC0-3) GN=tal PE=3 SV=1 42 292 6.0E-15
sp|Q9W1G0|TALDO_DROME Probable transaldolase OS=Drosophila melanogaster GN=Taldo PE=2 SV=2 44 295 7.0E-15
sp|A2BVI1|TAL_PROM5 Transaldolase OS=Prochlorococcus marinus (strain MIT 9515) GN=tal PE=3 SV=1 38 221 7.0E-15
sp|B4E6F9|TAL_BURCJ Transaldolase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=tal PE=3 SV=1 42 296 7.0E-15
sp|P51778|TAL_ANAVT Transaldolase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tal PE=3 SV=2 43 222 7.0E-15
sp|Q39E45|TAL_BURL3 Transaldolase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tal PE=3 SV=1 42 296 7.0E-15
sp|Q9Z998|TAL_CHLPN Transaldolase OS=Chlamydia pneumoniae GN=tal PE=3 SV=1 37 229 7.0E-15
sp|Q47WR3|TAL_COLP3 Transaldolase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tal PE=3 SV=1 44 222 7.0E-15
sp|Q602L8|TAL_METCA Transaldolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tal PE=3 SV=1 44 239 8.0E-15
sp|P58561|TAL_NOSS1 Transaldolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tal PE=3 SV=1 43 222 8.0E-15
sp|A3MYD4|TAL_ACTP2 Transaldolase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tal PE=3 SV=1 44 224 8.0E-15
sp|A6VLW0|TAL_ACTSZ Transaldolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tal PE=3 SV=1 44 219 8.0E-15
sp|Q8VI73|TALDO_CRIGR Transaldolase OS=Cricetulus griseus GN=TALDO1 PE=2 SV=1 18 221 9.0E-15
sp|B0UV30|TAL_HISS2 Transaldolase OS=Histophilus somni (strain 2336) GN=tal PE=3 SV=1 44 219 1.0E-14
sp|B2JE74|TAL_BURP8 Transaldolase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=tal PE=3 SV=1 45 296 1.0E-14
sp|B9JAX6|TAL_AGRRK Transaldolase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tal PE=3 SV=1 60 221 1.0E-14
sp|Q0I1U0|TAL_HAES1 Transaldolase OS=Haemophilus somnus (strain 129Pt) GN=tal PE=3 SV=1 44 219 1.0E-14
sp|B9MDC2|TAL_ACIET Transaldolase OS=Acidovorax ebreus (strain TPSY) GN=tal PE=3 SV=1 45 293 2.0E-14
sp|Q7V2G1|TAL_PROMP Transaldolase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tal PE=3 SV=1 13 221 2.0E-14
sp|A9AIJ8|TAL_BURM1 Transaldolase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tal PE=3 SV=1 42 296 2.0E-14
sp|A1W3W5|TAL_ACISJ Transaldolase OS=Acidovorax sp. (strain JS42) GN=tal PE=3 SV=1 45 293 2.0E-14
sp|B5EUF3|TAL_VIBFM Transaldolase OS=Vibrio fischeri (strain MJ11) GN=tal PE=3 SV=1 46 292 2.0E-14
sp|Q255E4|TAL_CHLFF Transaldolase OS=Chlamydophila felis (strain Fe/C-56) GN=tal PE=3 SV=1 37 226 2.0E-14
sp|A3N794|TAL_BURP6 Transaldolase OS=Burkholderia pseudomallei (strain 668) GN=tal PE=3 SV=1 45 296 2.0E-14
sp|Q3JUL7|TAL_BURP1 Transaldolase OS=Burkholderia pseudomallei (strain 1710b) GN=tal PE=3 SV=2 45 296 2.0E-14
sp|Q5DZP1|TAL_VIBF1 Transaldolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tal PE=3 SV=1 46 292 2.0E-14
sp|Q63W00|TAL_BURPS Transaldolase OS=Burkholderia pseudomallei (strain K96243) GN=tal PE=3 SV=1 45 296 2.0E-14
sp|A3NSY2|TAL_BURP0 Transaldolase OS=Burkholderia pseudomallei (strain 1106a) GN=tal PE=3 SV=1 45 296 2.0E-14
sp|A1V2A0|TAL_BURMS Transaldolase OS=Burkholderia mallei (strain SAVP1) GN=tal PE=3 SV=1 45 296 3.0E-14
sp|Q62ID7|TAL_BURMA Transaldolase OS=Burkholderia mallei (strain ATCC 23344) GN=tal PE=3 SV=1 45 296 3.0E-14
sp|A3MHY5|TAL_BURM7 Transaldolase OS=Burkholderia mallei (strain NCTC 10247) GN=tal PE=3 SV=1 45 296 3.0E-14
sp|Q4QLG9|TAL_HAEI8 Transaldolase OS=Haemophilus influenzae (strain 86-028NP) GN=tal PE=3 SV=1 44 219 3.0E-14
sp|A1VJZ5|TAL_POLNA Transaldolase OS=Polaromonas naphthalenivorans (strain CJ2) GN=tal PE=3 SV=1 45 220 3.0E-14
sp|A5UCY0|TAL_HAEIE Transaldolase OS=Haemophilus influenzae (strain PittEE) GN=tal PE=3 SV=1 44 219 4.0E-14
sp|P45055|TAL_HAEIN Transaldolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tal PE=3 SV=2 44 219 4.0E-14
sp|B3Q0T5|TAL_RHIE6 Transaldolase OS=Rhizobium etli (strain CIAT 652) GN=tal PE=3 SV=1 43 221 4.0E-14
sp|A5UIP9|TAL_HAEIG Transaldolase OS=Haemophilus influenzae (strain PittGG) GN=tal PE=3 SV=1 44 219 5.0E-14
sp|Q9CKH9|TALB_PASMU Transaldolase B OS=Pasteurella multocida (strain Pm70) GN=talB PE=3 SV=1 44 223 5.0E-14
sp|Q87GY5|TAL_VIBPA Transaldolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tal PE=3 SV=1 46 213 5.0E-14
sp|Q21ZD6|TAL_RHOFT Transaldolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tal PE=3 SV=1 40 292 6.0E-14
sp|A7N1Z7|TAL_VIBCB Transaldolase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=tal PE=3 SV=1 46 213 6.0E-14
sp|Q2NS86|TAL_SODGM Transaldolase OS=Sodalis glossinidius (strain morsitans) GN=tal PE=3 SV=1 44 241 6.0E-14
sp|Q6MAI4|TAL_PARUW Transaldolase OS=Protochlamydia amoebophila (strain UWE25) GN=tal PE=3 SV=1 43 293 6.0E-14
sp|Q5L5I5|TAL_CHLAB Transaldolase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tal PE=3 SV=1 37 227 7.0E-14
sp|P15019|TAL1_YEAST Transaldolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAL1 PE=1 SV=4 42 282 8.0E-14
sp|A2C0X8|TAL_PROM1 Transaldolase OS=Prochlorococcus marinus (strain NATL1A) GN=tal PE=3 SV=1 44 222 9.0E-14
sp|Q1LLK8|TAL_CUPMC Transaldolase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tal PE=3 SV=1 45 220 1.0E-13
sp|C1F2H6|TAL_ACIC5 Transaldolase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=tal PE=3 SV=1 36 235 1.0E-13
sp|B1ZUE6|TAL_OPITP Transaldolase OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=tal PE=3 SV=1 45 296 2.0E-13
sp|B6ERE2|TAL_ALISL Transaldolase OS=Aliivibrio salmonicida (strain LFI1238) GN=tal PE=3 SV=1 46 219 2.0E-13
sp|Q8D6H9|TAL_VIBVU Transaldolase OS=Vibrio vulnificus (strain CMCP6) GN=tal PE=3 SV=1 46 213 2.0E-13
sp|Q6LLF0|TAL_PHOPR Transaldolase OS=Photobacterium profundum GN=tal PE=3 SV=1 46 219 2.0E-13
sp|Q89AY3|TAL_BUCBP Transaldolase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tal PE=3 SV=1 42 219 2.0E-13
sp|Q7MDD5|TAL_VIBVY Transaldolase OS=Vibrio vulnificus (strain YJ016) GN=tal PE=3 SV=1 46 213 2.0E-13
sp|Q46GQ7|TAL_PROMT Transaldolase OS=Prochlorococcus marinus (strain NATL2A) GN=tal PE=3 SV=1 44 222 3.0E-13
sp|Q822J3|TAL_CHLCV Transaldolase OS=Chlamydophila caviae (strain GPIC) GN=tal PE=3 SV=1 37 221 3.0E-13
sp|Q7VRT4|TAL_BLOFL Transaldolase OS=Blochmannia floridanus GN=tal PE=3 SV=1 44 229 4.0E-13
sp|B9JST0|TAL_AGRVS Transaldolase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=tal PE=3 SV=1 34 218 4.0E-13
sp|B2T236|TAL_BURPP Transaldolase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=tal PE=3 SV=1 45 296 2.0E-12
sp|Q142S4|TAL_BURXL Transaldolase OS=Burkholderia xenovorans (strain LB400) GN=tal PE=3 SV=1 45 219 3.0E-12
sp|Q168B1|TAL_ROSDO Probable transaldolase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tal PE=3 SV=1 73 220 5.0E-12
sp|A4WRW1|TAL_RHOS5 Probable transaldolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tal PE=3 SV=1 79 221 9.0E-12
sp|Q1QZV1|TAL_CHRSD Transaldolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=tal PE=3 SV=1 18 213 1.0E-11
sp|Q7VP02|TAL_HAEDU Transaldolase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tal PE=3 SV=1 44 223 1.0E-11
sp|C4K4G2|TAL_HAMD5 Transaldolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tal PE=3 SV=1 41 229 1.0E-11
sp|B9KKW2|TAL_RHOSK Probable transaldolase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=tal PE=3 SV=1 77 221 3.0E-11
sp|Q3J0F0|TAL_RHOS4 Probable transaldolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tal PE=3 SV=1 77 221 3.0E-11
sp|A3PLV0|TAL_RHOS1 Probable transaldolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tal PE=3 SV=1 77 221 3.0E-11
sp|Q2RUN7|TAL_RHORT Transaldolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tal PE=3 SV=1 28 281 6.0E-11
sp|Q1JFK0|TAL_STRPD Probable transaldolase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=tal PE=3 SV=1 101 234 1.0E-10
sp|B8E200|TAL_DICTD Probable transaldolase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=tal PE=3 SV=1 101 221 1.0E-10
sp|Q927A3|TAL1_LISIN Probable transaldolase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tal1 PE=3 SV=1 73 195 2.0E-10
sp|Q81MY9|TAL2_BACAN Probable transaldolase 2 OS=Bacillus anthracis GN=tal2 PE=3 SV=1 101 195 2.0E-10
sp|Q81B21|TAL2_BACCR Probable transaldolase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tal2 PE=3 SV=1 96 195 4.0E-10
sp|Q8YJ42|TAL_BRUME Probable transaldolase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|Q6G1W4|TAL_BARHE Probable transaldolase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|Q8FYQ9|TAL_BRUSU Probable transaldolase OS=Brucella suis biovar 1 (strain 1330) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|A9WWS9|TAL_BRUSI Probable transaldolase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|A5VSE7|TAL_BRUO2 Probable transaldolase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|C0RF56|TAL_BRUMB Probable transaldolase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|A9M843|TAL_BRUC2 Probable transaldolase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|Q57B82|TAL_BRUAB Probable transaldolase OS=Brucella abortus biovar 1 (strain 9-941) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|Q2YLI1|TAL_BRUA2 Probable transaldolase OS=Brucella abortus (strain 2308) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|B2S7M9|TAL_BRUA1 Probable transaldolase OS=Brucella abortus (strain S19) GN=tal PE=3 SV=1 101 221 5.0E-10
sp|B5XMM1|TAL_STRPZ Probable transaldolase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|P0DG13|TAL_STRPQ Probable transaldolase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|Q48RY1|TAL_STRPM Probable transaldolase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|A2RD32|TAL_STRPG Probable transaldolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|Q1J5E9|TAL_STRPF Probable transaldolase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|Q1JKK8|TAL_STRPC Probable transaldolase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|Q1JAF7|TAL_STRPB Probable transaldolase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|P66961|TAL_STRP8 Probable transaldolase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|Q5XAK4|TAL_STRP6 Probable transaldolase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|P0DG12|TAL_STRP3 Probable transaldolase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=tal PE=3 SV=1 101 234 6.0E-10
sp|P66959|TAL_STRP1 Probable transaldolase OS=Streptococcus pyogenes serotype M1 GN=tal PE=3 SV=1 101 234 6.0E-10
sp|Q8KA27|TAL_BUCAP Transaldolase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tal PE=3 SV=1 44 223 7.0E-10
sp|Q8Y3T8|TAL1_LISMO Probable transaldolase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tal1 PE=3 SV=1 101 195 8.0E-10
sp|Q1GE05|TAL_RUEST Probable transaldolase OS=Ruegeria sp. (strain TM1040) GN=tal PE=3 SV=1 73 200 1.0E-09
sp|Q28TL3|TAL_JANSC Probable transaldolase OS=Jannaschia sp. (strain CCS1) GN=tal PE=3 SV=1 73 221 1.0E-09
sp|A8LNY7|TAL_DINSH Probable transaldolase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=tal PE=3 SV=1 79 221 1.0E-09
sp|A9KPQ3|TAL_CLOPH Probable transaldolase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=tal PE=3 SV=1 101 195 1.0E-09
sp|Q5LNS5|TAL_RUEPO Probable transaldolase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tal PE=3 SV=1 73 200 1.0E-09
sp|Q0AQJ7|TAL_MARMM Probable transaldolase OS=Maricaulis maris (strain MCS10) GN=tal PE=3 SV=1 73 221 1.0E-09
sp|A9MI17|FSA_SALAR Fructose-6-phosphate aldolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=fsa PE=3 SV=1 54 196 2.0E-09
sp|A6WXW5|TAL_OCHA4 Probable transaldolase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tal PE=3 SV=1 101 221 2.0E-09
sp|C0MGU8|TAL_STRS7 Probable transaldolase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=tal PE=3 SV=1 101 234 2.0E-09
sp|B4U4L6|TAL_STREM Probable transaldolase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=tal PE=3 SV=1 101 234 2.0E-09
sp|A7HT46|TAL_PARL1 Probable transaldolase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tal PE=3 SV=1 73 220 2.0E-09
sp|C0M7L5|TAL_STRE4 Probable transaldolase OS=Streptococcus equi subsp. equi (strain 4047) GN=tal PE=3 SV=1 101 234 2.0E-09
sp|A9IYY3|TAL_BART1 Probable transaldolase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tal PE=3 SV=1 101 219 2.0E-09
sp|B8D6Z9|TAL_BUCAT Transaldolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=tal PE=3 SV=1 44 295 4.0E-09
sp|P57194|TAL_BUCAI Transaldolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tal PE=3 SV=1 44 295 4.0E-09
sp|B8D8P5|TAL_BUCA5 Transaldolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=tal PE=3 SV=1 44 295 4.0E-09
sp|Q6FYL8|TAL_BARQU Probable transaldolase OS=Bartonella quintana (strain Toulouse) GN=tal PE=3 SV=1 101 221 4.0E-09
sp|A6UDM7|TAL_SINMW Probable transaldolase OS=Sinorhizobium medicae (strain WSM419) GN=tal PE=3 SV=1 101 221 4.0E-09
sp|Q71W21|TAL1_LISMF Probable transaldolase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tal1 PE=3 SV=1 101 195 6.0E-09
sp|Q24ML5|TAL_DESHY Probable transaldolase OS=Desulfitobacterium hafniense (strain Y51) GN=tal PE=3 SV=1 101 208 7.0E-09
sp|B8FZ81|TAL_DESHD Probable transaldolase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tal PE=3 SV=1 101 208 7.0E-09
sp|Q5LAU6|TAL_BACFN Probable transaldolase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tal PE=3 SV=1 102 204 7.0E-09
sp|P19669|TAL_BACSU Transaldolase OS=Bacillus subtilis (strain 168) GN=tal PE=1 SV=4 101 195 8.0E-09
sp|Q64R94|TAL_BACFR Probable transaldolase OS=Bacteroides fragilis (strain YCH46) GN=tal PE=3 SV=1 102 204 8.0E-09
sp|Q92LK3|TAL_RHIME Probable transaldolase OS=Rhizobium meliloti (strain 1021) GN=tal PE=3 SV=1 101 221 9.0E-09
sp|A8FIE1|TAL_BACP2 Probable transaldolase OS=Bacillus pumilus (strain SAFR-032) GN=tal PE=3 SV=1 101 195 1.0E-08
sp|B1L010|TAL_CLOBM Probable transaldolase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tal PE=3 SV=1 73 196 1.0E-08
sp|C1FL18|TAL_CLOBJ Probable transaldolase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=tal PE=3 SV=1 73 196 2.0E-08
sp|C3KTY4|TAL_CLOB6 Probable transaldolase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=tal PE=3 SV=1 73 196 2.0E-08
sp|Q5WB47|TAL_BACSK Probable transaldolase OS=Bacillus clausii (strain KSM-K16) GN=tal PE=3 SV=1 55 195 2.0E-08
sp|C3M9S7|TAL_RHISN Probable transaldolase OS=Rhizobium sp. (strain NGR234) GN=tal PE=3 SV=1 101 221 2.0E-08
sp|Q11DE1|TAL_CHESB Probable transaldolase OS=Chelativorans sp. (strain BNC1) GN=tal PE=3 SV=1 101 221 2.0E-08
sp|A5I1C9|TAL_CLOBH Probable transaldolase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tal PE=3 SV=1 73 196 2.0E-08
sp|A7FTH1|TAL_CLOB1 Probable transaldolase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tal PE=3 SV=1 73 196 2.0E-08
sp|C0QVC8|TAL_BRAHW Probable transaldolase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=tal PE=3 SV=1 101 195 3.0E-08
sp|B5XZ23|FSA_KLEP3 Fructose-6-phosphate aldolase OS=Klebsiella pneumoniae (strain 342) GN=fsa PE=3 SV=1 54 196 3.0E-08
sp|A8ZW56|TAL_DESOH Probable transaldolase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=tal PE=3 SV=1 101 196 3.0E-08
sp|Q97JD9|TAL_CLOAB Probable transaldolase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=tal PE=3 SV=1 73 196 3.0E-08
sp|A1UR41|TAL_BARBK Probable transaldolase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=tal PE=3 SV=1 100 220 3.0E-08
sp|Q8A767|TAL_BACTN Probable transaldolase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tal PE=3 SV=1 102 208 4.0E-08
sp|A6GYG9|TAL_FLAPJ Probable transaldolase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tal PE=3 SV=1 101 208 5.0E-08
sp|A5CYD0|TAL_PELTS Probable transaldolase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tal PE=3 SV=1 101 195 6.0E-08
sp|A6TGD7|FSA_KLEP7 Fructose-6-phosphate aldolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fsa PE=3 SV=1 45 196 6.0E-08
sp|B7IE29|TAL_THEAB Probable transaldolase OS=Thermosipho africanus (strain TCF52B) GN=tal PE=3 SV=1 88 195 7.0E-08
sp|C4ZF71|TAL_EUBR3 Probable transaldolase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tal PE=3 SV=1 101 196 7.0E-08
sp|A9AZ03|TAL_HERA2 Probable transaldolase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=tal PE=3 SV=1 52 195 7.0E-08
sp|Q8DXP1|TAL_STRA5 Probable transaldolase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=tal PE=3 SV=1 101 201 7.0E-08
sp|Q8E3B1|TAL_STRA3 Probable transaldolase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=tal PE=3 SV=1 101 201 7.0E-08
sp|A4J9C4|TAL_DESRM Probable transaldolase OS=Desulfotomaculum reducens (strain MI-1) GN=tal PE=3 SV=1 101 202 8.0E-08
sp|B3EQ72|TAL_CHLPB Probable transaldolase OS=Chlorobium phaeobacteroides (strain BS1) GN=tal PE=3 SV=1 101 195 8.0E-08
sp|B0T583|TAL_CAUSK Probable transaldolase OS=Caulobacter sp. (strain K31) GN=tal PE=3 SV=1 60 213 8.0E-08
sp|A5IKB4|TAL_THEP1 Probable transaldolase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tal PE=3 SV=1 102 221 8.0E-08
sp|B5YHV2|TAL_THEYD Probable transaldolase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=tal PE=3 SV=1 100 196 9.0E-08
sp|Q0BX85|TAL_HYPNA Probable transaldolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=tal PE=3 SV=1 79 196 9.0E-08
sp|Q5SJE8|TAL_THET8 Probable transaldolase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tal PE=1 SV=1 73 195 9.0E-08
sp|Q9A2F1|TAL_CAUCR Probable transaldolase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tal PE=3 SV=1 60 213 1.0E-07
sp|B8H6D3|TAL_CAUCN Probable transaldolase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=tal PE=3 SV=1 60 213 1.0E-07
sp|A5GBY8|TAL_GEOUR Probable transaldolase OS=Geobacter uraniireducens (strain Rf4) GN=tal PE=3 SV=1 101 221 1.0E-07
sp|A6TK31|TAL_ALKMQ Probable transaldolase OS=Alkaliphilus metalliredigens (strain QYMF) GN=tal PE=3 SV=1 101 195 1.0E-07
sp|B5RF58|FSA_SALG2 Fructose-6-phosphate aldolase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|B1L9J1|TAL_THESQ Probable transaldolase OS=Thermotoga sp. (strain RQ2) GN=tal PE=3 SV=1 102 221 1.0E-07
sp|B4TCP9|FSA_SALHS Fructose-6-phosphate aldolase OS=Salmonella heidelberg (strain SL476) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|B3E1K9|TAL_GEOLS Probable transaldolase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=tal PE=3 SV=1 101 195 1.0E-07
sp|Q8Z305|FSA_SALTI Fructose-6-phosphate aldolase OS=Salmonella typhi GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|Q8ZKM8|FSA_SALTY Fructose-6-phosphate aldolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|B5BJM7|FSA_SALPK Fructose-6-phosphate aldolase OS=Salmonella paratyphi A (strain AKU_12601) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|C0Q463|FSA_SALPC Fructose-6-phosphate aldolase OS=Salmonella paratyphi C (strain RKS4594) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|A9N0F4|FSA_SALPB Fructose-6-phosphate aldolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|Q5PK58|FSA_SALPA Fructose-6-phosphate aldolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|B4T0V8|FSA_SALNS Fructose-6-phosphate aldolase OS=Salmonella newport (strain SL254) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|B5QXP2|FSA_SALEP Fructose-6-phosphate aldolase OS=Salmonella enteritidis PT4 (strain P125109) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|B5FPW2|FSA_SALDC Fructose-6-phosphate aldolase OS=Salmonella dublin (strain CT_02021853) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|Q57HA5|FSA_SALCH Fructose-6-phosphate aldolase OS=Salmonella choleraesuis (strain SC-B67) GN=fsa PE=3 SV=1 54 196 1.0E-07
sp|Q748M4|TAL_GEOSL Probable transaldolase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tal PE=3 SV=1 101 161 1.0E-07
sp|Q6AR67|TAL_DESPS Probable transaldolase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tal PE=3 SV=1 101 155 1.0E-07
sp|A7Z9T0|TAL_BACMF Probable transaldolase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tal PE=3 SV=1 101 195 1.0E-07
sp|B4S6D0|TAL_PROA2 Probable transaldolase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tal PE=3 SV=1 101 161 2.0E-07
sp|Q39YD4|TAL_GEOMG Probable transaldolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tal PE=3 SV=1 101 161 2.0E-07
sp|Q67TE2|TAL_SYMTH Probable transaldolase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tal PE=3 SV=1 79 200 2.0E-07
sp|Q2IGW6|TAL_ANADE Probable transaldolase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tal PE=3 SV=1 60 195 2.0E-07
sp|B8JAM9|TAL_ANAD2 Probable transaldolase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tal PE=3 SV=1 60 195 2.0E-07
sp|C0QIA5|TAL_DESAH Probable transaldolase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=tal PE=3 SV=1 101 220 2.0E-07
sp|Q9RUP6|TAL_DEIRA Probable transaldolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tal PE=3 SV=2 101 166 2.0E-07
sp|A0LEA2|TAL_SYNFM Probable transaldolase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=tal PE=3 SV=1 102 196 2.0E-07
sp|Q72JR7|TAL_THET2 Probable transaldolase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tal PE=3 SV=1 73 195 2.0E-07
sp|Q9WYD1|TAL_THEMA Transaldolase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tal PE=1 SV=1 102 221 2.0E-07
sp|C5D9P4|TAL_GEOSW Probable transaldolase OS=Geobacillus sp. (strain WCH70) GN=tal PE=3 SV=1 101 195 3.0E-07
sp|B4TQG9|FSA_SALSV Fructose-6-phosphate aldolase OS=Salmonella schwarzengrund (strain CVM19633) GN=fsa PE=3 SV=1 54 196 3.0E-07
sp|B0K6D2|TAL_THEPX Probable transaldolase OS=Thermoanaerobacter sp. (strain X514) GN=tal PE=3 SV=1 101 161 3.0E-07
sp|Q88S98|TAL_LACPL Probable transaldolase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tal PE=3 SV=1 100 195 3.0E-07
sp|Q7MXG0|TAL_PORGI Probable transaldolase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=tal PE=3 SV=1 101 161 3.0E-07
sp|B2RHK7|TAL_PORG3 Probable transaldolase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tal PE=3 SV=1 101 161 3.0E-07
sp|A6UTP5|TAL_META3 Probable transaldolase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tal PE=3 SV=1 101 195 4.0E-07
sp|C6C0W4|TAL_DESAD Probable transaldolase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=tal PE=3 SV=1 101 195 5.0E-07
sp|B4UHE7|TAL_ANASK Probable transaldolase OS=Anaeromyxobacter sp. (strain K) GN=tal PE=3 SV=1 60 195 5.0E-07
sp|C5CGH2|TAL_KOSOT Probable transaldolase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tal PE=3 SV=1 102 219 5.0E-07
sp|A7HME3|TAL_FERNB Probable transaldolase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tal PE=3 SV=1 102 219 5.0E-07
sp|B5ED52|TAL_GEOBB Probable transaldolase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=tal PE=3 SV=1 101 195 5.0E-07
sp|A4ITL5|TAL_GEOTN Probable transaldolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tal PE=3 SV=1 101 195 5.0E-07
sp|A7GCY3|TAL_CLOBL Probable transaldolase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tal PE=3 SV=1 73 196 6.0E-07
sp|B1IJR0|TAL_CLOBK Probable transaldolase OS=Clostridium botulinum (strain Okra / Type B1) GN=tal PE=3 SV=1 73 196 6.0E-07
sp|A4FWM6|TAL_METM5 Probable transaldolase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tal PE=3 SV=1 101 195 6.0E-07
sp|A6UPV2|TAL_METVS Probable transaldolase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tal PE=3 SV=1 101 195 7.0E-07
sp|P66957|TAL2_LISMO Probable transaldolase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tal2 PE=3 SV=1 101 202 9.0E-07
sp|Q723W2|TAL2_LISMF Probable transaldolase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tal2 PE=3 SV=1 101 202 9.0E-07
sp|P66958|TAL2_LISIN Probable transaldolase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tal2 PE=3 SV=1 101 202 9.0E-07
sp|Q8R8S6|TAL_CALS4 Probable transaldolase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tal PE=3 SV=1 101 161 1.0E-06
sp|A6L5J5|TAL_BACV8 Probable transaldolase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tal PE=3 SV=1 102 208 1.0E-06
sp|Q98EV0|TAL_RHILO Probable transaldolase OS=Rhizobium loti (strain MAFF303099) GN=tal PE=3 SV=1 104 221 1.0E-06
sp|B9M1X7|TAL_GEODF Probable transaldolase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=tal PE=3 SV=1 101 195 1.0E-06
sp|A6VGP5|TAL_METM7 Probable transaldolase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tal PE=3 SV=1 73 195 1.0E-06
sp|A9A413|TAL_NITMS Probable transaldolase OS=Nitrosopumilus maritimus (strain SCM1) GN=tal PE=3 SV=1 101 161 1.0E-06
sp|A9AA06|TAL_METM6 Probable transaldolase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tal PE=3 SV=1 101 195 1.0E-06
sp|A1AKQ8|TAL_PELPD Probable transaldolase OS=Pelobacter propionicus (strain DSM 2379) GN=tal PE=3 SV=1 100 195 1.0E-06
sp|B5F0U2|FSA_SALA4 Fructose-6-phosphate aldolase OS=Salmonella agona (strain SL483) GN=fsa PE=3 SV=1 54 196 1.0E-06
sp|B5Y9V1|TAL_COPPD Probable transaldolase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=tal PE=3 SV=1 101 195 1.0E-06
sp|Q6LXP1|TAL_METMP Probable transaldolase OS=Methanococcus maripaludis (strain S2 / LL) GN=tal PE=3 SV=1 73 195 2.0E-06
sp|B0SQ07|TAL_LEPBP Probable transaldolase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=tal PE=3 SV=1 101 195 2.0E-06
sp|B0SGW0|TAL_LEPBA Probable transaldolase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=tal PE=3 SV=1 101 195 2.0E-06
sp|A4W8H0|FSA_ENT38 Fructose-6-phosphate aldolase OS=Enterobacter sp. (strain 638) GN=fsa PE=3 SV=1 102 196 2.0E-06
sp|B2A3J5|TAL_NATTJ Probable transaldolase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=tal PE=3 SV=1 101 195 2.0E-06
sp|Q6MRM6|TAL_BDEBA Probable transaldolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=tal PE=3 SV=1 73 155 2.0E-06
sp|A1BJV5|TAL_CHLPD Probable transaldolase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=tal PE=3 SV=1 101 195 2.0E-06
sp|Q6HNE4|TAL_BACHK Probable transaldolase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tal PE=3 SV=1 78 195 3.0E-06
sp|Q63FX6|TAL_BACCZ Probable transaldolase OS=Bacillus cereus (strain ZK / E33L) GN=tal PE=3 SV=1 78 195 3.0E-06
sp|Q73DH4|TAL_BACC1 Probable transaldolase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tal PE=3 SV=1 78 195 3.0E-06
sp|Q81V33|TAL1_BACAN Probable transaldolase 1 OS=Bacillus anthracis GN=tal1 PE=3 SV=1 78 195 3.0E-06
sp|Q81HW6|TAL1_BACCR Probable transaldolase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tal1 PE=3 SV=1 78 195 3.0E-06
sp|A7H783|TAL_ANADF Probable transaldolase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tal PE=3 SV=1 101 195 3.0E-06
sp|Q3AFT3|TAL_CARHZ Probable transaldolase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tal PE=3 SV=1 101 203 4.0E-06
sp|A4SGX9|TAL_CHLPM Probable transaldolase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tal PE=3 SV=1 101 161 4.0E-06
sp|A7GLA6|TAL_BACCN Probable transaldolase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=tal PE=3 SV=1 78 195 5.0E-06
sp|Q2N908|TAL_ERYLH Probable transaldolase OS=Erythrobacter litoralis (strain HTCC2594) GN=tal PE=3 SV=1 104 221 6.0E-06
sp|Q185K3|TAL_PEPD6 Probable transaldolase OS=Peptoclostridium difficile (strain 630) GN=tal PE=3 SV=1 101 155 7.0E-06
sp|A1B4Z2|TAL_PARDP Probable transaldolase OS=Paracoccus denitrificans (strain Pd 1222) GN=tal PE=3 SV=1 101 221 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3731
MRRCHAEIYAQLVKQCNQALIVESLACASSFAVGFPDVSPEELAVDVATVKLALQMATKVPGSVHVMTNPQQAFS
QKKLVQHGRRYHNLAGRLDPGFDRSRLVMKVAATWEGLQACRQLRDEGIKTLATTVFTIEQAILAGEVGCVSVSP
FINELKALFDDTYEGSVPNPGLCAEAQRYYERHALPTRVKACANRTLAEVEQLVGIAAFTIAPDDLEALARTGCS
AEEEEPGSFDMGHAGASGAGTYAAVYLDDEYKYRIDFSARDGGAGQHKLGQALSIFCDFQHKLEHMMRQHR*
Coding >Hirsu2|3731
ATGCGTCGATGCCACGCCGAGATCTACGCCCAGCTCGTCAAGCAATGCAACCAGGCTCTCATCGTCGAGTCTCTG
GCGTGCGCGAGCTCGTTCGCTGTCGGCTTTCCCGACGTCTCGCCTGAAGAGCTCGCGGTTGATGTTGCGACGGTC
AAGCTCGCCTTGCAGATGGCGACCAAAGTCCCGGGGTCGGTCCATGTCATGACGAACCCCCAGCAAGCCTTCTCC
CAGAAGAAGCTGGTTCAGCACGGCAGACGCTACCACAACCTGGCCGGCCGTCTCGACCCCGGGTTCGACCGCTCT
CGGCTGGTCATGAAAGTGGCGGCAACGTGGGAAGGTCTGCAAGCCTGCCGCCAACTGAGGGACGAAGGCATCAAG
ACGCTGGCCACAACCGTCTTCACCATCGAGCAGGCGATCCTGGCCGGTGAGGTCGGCTGCGTCTCCGTCTCACCC
TTCATCAACGAGCTCAAAGCGCTGTTCGACGACACATACGAGGGCTCTGTGCCCAACCCGGGCCTCTGCGCCGAG
GCCCAGCGGTACTACGAGCGCCACGCGCTGCCGACGCGGGTCAAGGCATGCGCCAACCGGACCCTCGCCGAGGTG
GAGCAGCTCGTCGGCATCGCGGCCTTCACGATCGCCCCGGACGACCTCGAGGCCCTGGCCCGGACCGGCTGCTCG
GCCGAGGAGGAGGAGCCCGGGTCTTTCGACATGGGGCACGCGGGGGCGAGCGGCGCCGGCACCTATGCTGCCGTC
TACTTGGACGACGAATACAAGTACCGGATCGATTTCAGTGCCCGGGACGGCGGCGCTGGCCAGCATAAGCTCGGA
CAGGCGCTTTCGATATTCTGTGACTTCCAACACAAGCTTGAGCATATGATGCGACAGCACCGTTGA
Transcript >Hirsu2|3731
ATGCGTCGATGCCACGCCGAGATCTACGCCCAGCTCGTCAAGCAATGCAACCAGGCTCTCATCGTCGAGTCTCTG
GCGTGCGCGAGCTCGTTCGCTGTCGGCTTTCCCGACGTCTCGCCTGAAGAGCTCGCGGTTGATGTTGCGACGGTC
AAGCTCGCCTTGCAGATGGCGACCAAAGTCCCGGGGTCGGTCCATGTCATGACGAACCCCCAGCAAGCCTTCTCC
CAGAAGAAGCTGGTTCAGCACGGCAGACGCTACCACAACCTGGCCGGCCGTCTCGACCCCGGGTTCGACCGCTCT
CGGCTGGTCATGAAAGTGGCGGCAACGTGGGAAGGTCTGCAAGCCTGCCGCCAACTGAGGGACGAAGGCATCAAG
ACGCTGGCCACAACCGTCTTCACCATCGAGCAGGCGATCCTGGCCGGTGAGGTCGGCTGCGTCTCCGTCTCACCC
TTCATCAACGAGCTCAAAGCGCTGTTCGACGACACATACGAGGGCTCTGTGCCCAACCCGGGCCTCTGCGCCGAG
GCCCAGCGGTACTACGAGCGCCACGCGCTGCCGACGCGGGTCAAGGCATGCGCCAACCGGACCCTCGCCGAGGTG
GAGCAGCTCGTCGGCATCGCGGCCTTCACGATCGCCCCGGACGACCTCGAGGCCCTGGCCCGGACCGGCTGCTCG
GCCGAGGAGGAGGAGCCCGGGTCTTTCGACATGGGGCACGCGGGGGCGAGCGGCGCCGGCACCTATGCTGCCGTC
TACTTGGACGACGAATACAAGTACCGGATCGATTTCAGTGCCCGGGACGGCGGCGCTGGCCAGCATAAGCTCGGA
CAGGCGCTTTCGATATTCTGTGACTTCCAACACAAGCTTGAGCATATGATGCGACAGCACCGTTGA
Gene >Hirsu2|3731
ATGCGTCGATGCCACGTCCAACCAGGTGACTCTTTGCTCCGCGCGTCTTGGCCATCACGTCTCATCAGTTGCTGA
CCGAGAAAAGGCCGAGATCTACGCCCAGCTCGTCAAGCAATGCAACCAGGCTCTCATCGTCGAGTCTCTGGCGTG
CGCGAGCTCGTTCGCTGTCGGCTTTCCCGACGTCTCGCCTGAAGAGCTCGCGGTTGATGTTGCGGTGCGTCAGGG
CATTGGTCTTGGCCTTGGCCACGCTCTCTGCTGACGCGCGAGTTAGACGGTCAAGCTCGCCTTGCAGATGGCGAC
CAAAGTCCCGGGGTCGGTCCATGTCATGACGAACCCCCAGCAAGCCTTCTCCCAGAAGAAGCTGGTTCAGCACGG
CAGACGTATGATTATCCTCACCTTAATGACCATCATTGGTGTCTATCACGAGAAGGGACACTGACAACGAGGTGA
TGGTGCATTCATCTCAAGGCTACCACAACCTGGCCGGCCGTCTCGACCCCGGGTTCGACCGCTCTCGGCTGGTCA
TGAAAGTGGCGGCAACGTGGGAAGGTCTGCAAGCCTGCCGCCAACTGAGGGACGAAGGCATCAAGACGCTGGCCA
CAACCGTCTTCACCATCGAGCAGGCGATCCTGGCCGGTGAGGTCGGCTGCGTCTCCGTCTCACCCTTCATCAACG
AGCTCAAAGCGCTGTTCGACGACACGTACGTTCGCCCTCCACCCCTGACACTGGAGCATGGAGGCCGTGGGAATG
CGAGAGTCCAACAGTCACCGAACAAACAGATACGAGGGCTCTGTGCCCAACCCGGGCCTCTGCGCCGAGGCCCAG
CGGTACTACGAGCGCCACGCGCTGCCGACGCGGGTCAAGGCATGCGCCAACCGGACCCTCGCCGAGGTGGAGCAG
CTCGTCGGCATCGCGGCCTTCACGATCGCCCCGGACGACCTCGAGGCCCTGGCCCGGACCGGCTGCTCGGCCGAG
GAGGAGGAGCCCGGGTCTTTCGACATGGGGCACGCGGGGGCGAGCGGCGCCGGCACCTATGCTGCCGTCTACTTG
GACGACGAATACAAGTACCGGATCGATTTCAGTGCCCGGGACGGCGGCGCTGGCCAGCATAAGCTCGGACAGGCG
CTTTCGATATTCTGTGACTTCCAACACAAGCTTGAGCATATGATGCGACAGCACCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail