Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3729
Gene name
LocationContig_2:77545..79315
Strand-
Gene length (bp)1770
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 3.3E-46 50 481
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-12 44 104
PF00890 FAD_binding_2 FAD binding domain 2.9E-05 41 77

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46882|AOFN_ASPNG Monoamine oxidase N OS=Aspergillus niger GN=maoN PE=1 SV=1 1 489 2.0E-123
sp|H8ZPX1|PNAO_PSESP Pseudooxynicotine oxidase OS=Pseudomonas sp. GN=pao PE=1 SV=1 40 486 2.0E-42
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 40 490 1.0E-23
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 40 485 4.0E-16
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 40 485 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46882|AOFN_ASPNG Monoamine oxidase N OS=Aspergillus niger GN=maoN PE=1 SV=1 1 489 2.0E-123
sp|H8ZPX1|PNAO_PSESP Pseudooxynicotine oxidase OS=Pseudomonas sp. GN=pao PE=1 SV=1 40 486 2.0E-42
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 40 490 1.0E-23
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 40 485 4.0E-16
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 40 485 2.0E-15
sp|P21398|AOFA_BOVIN Amine oxidase [flavin-containing] A OS=Bos taurus GN=MAOA PE=2 SV=2 40 485 1.0E-14
sp|Q8BW75|AOFB_MOUSE Amine oxidase [flavin-containing] B OS=Mus musculus GN=Maob PE=1 SV=4 41 485 1.0E-14
sp|Q64133|AOFA_MOUSE Amine oxidase [flavin-containing] A OS=Mus musculus GN=Maoa PE=1 SV=3 40 485 2.0E-14
sp|P19643|AOFB_RAT Amine oxidase [flavin-containing] B OS=Rattus norvegicus GN=Maob PE=1 SV=3 41 485 2.0E-14
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 50 485 2.0E-14
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 40 485 2.0E-14
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 40 485 7.0E-14
sp|P58027|AOFA_CANLF Amine oxidase [flavin-containing] A OS=Canis lupus familiaris GN=MAOA PE=2 SV=1 40 485 1.0E-13
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 41 485 1.0E-13
sp|P40974|PUO_KOCRO Putrescine oxidase OS=Kocuria rosea GN=puo PE=1 SV=1 41 482 4.0E-13
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 38 486 4.0E-13
sp|Q6PLK3|AOFB_PIG Amine oxidase [flavin-containing] B OS=Sus scrofa GN=MAOB PE=2 SV=3 50 485 7.0E-13
sp|P81383|OXLA_OPHHA L-amino-acid oxidase OS=Ophiophagus hannah PE=1 SV=3 39 481 8.0E-13
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 50 485 5.0E-12
sp|Q5RE98|AOFB_PONAB Amine oxidase [flavin-containing] B OS=Pongo abelii GN=MAOB PE=2 SV=3 50 485 1.0E-11
sp|Q7YRB7|AOFB_CANLF Amine oxidase [flavin-containing] B OS=Canis lupus familiaris GN=MAOB PE=2 SV=3 50 485 2.0E-11
sp|P21396|AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus GN=Maoa PE=1 SV=1 40 485 2.0E-10
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 56 484 8.0E-09
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 300 485 3.0E-08
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 26 330 4.0E-08
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 405 485 2.0E-07
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 42 482 5.0E-07
sp|P49253|AOF_ONCMY Amine oxidase [flavin-containing] OS=Oncorhynchus mykiss GN=mao PE=2 SV=2 35 324 8.0E-07
sp|P9WQ15|AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aofH PE=1 SV=1 37 124 1.0E-05
sp|P9WQ14|AOFH_MYCTO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aofH PE=3 SV=1 37 124 1.0E-05
sp|P63534|AOFH_MYCBO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aofH PE=3 SV=1 37 124 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3729
MSTRDGRSWMPGAGPEADLPCVAAITPSCNVERHTSPEPFDAIVIGAGYAGLIAARDLTTSGLKVLLLDGRDRLG
GRAWSTDLDGHPFEMGGSYVSDVHRHVWREITRYQLGVKAGPERKDEQNKAILIRDGEERHASQDERNRLLRSAV
MKIFNVDGAYGKLVMPTPLDEAALTVENRTAYDDMSIADRLAQLGDGLSADETAVVSSFVVMCTGSRAMDECSFY
ELLHWWCLCGHSPDAFFRNIGVYQLRRGQSSLARCIFDDALGSGRLAYALGTPVDAVRDGPDAATVRAGAGGRAF
RARRVVCTVPLNTLRRIAFDPPLPADKLAAADTNRRNGGAKINSRCAGADLRSWTCSDPDNGLICYSYESGSAAA
GTTNIVGFGQYPEGELDDAAVGERFGASIHESLRPHVKQIVFHNWSRDEYSNGSWFFPGPGLVTRYLDGLRRDHG
NVLFASSDWSTGWRGFIDGAMQEGARAAAGIVKSLRVERL*
Coding >Hirsu2|3729
ATGTCGACCCGAGATGGCCGCAGCTGGATGCCCGGCGCGGGCCCGGAAGCAGACTTACCGTGTGTCGCCGCCATC
ACGCCCTCGTGTAATGTAGAACGGCATACTTCGCCCGAGCCCTTCGACGCCATCGTCATCGGCGCCGGCTACGCG
GGCCTCATCGCGGCCCGAGATCTGACCACGTCCGGCCTAAAGGTTCTCTTGCTGGACGGCCGGGATCGACTGGGA
GGCCGCGCCTGGTCCACGGATCTCGACGGCCATCCGTTCGAGATGGGTGGCAGCTATGTCTCCGACGTGCACCGA
CACGTCTGGCGCGAGATCACTCGCTATCAGCTCGGCGTCAAGGCCGGGCCGGAGCGCAAGGACGAGCAGAACAAA
GCGATCCTGATTCGGGATGGCGAGGAGCGCCATGCGTCCCAGGACGAAAGGAACCGACTGCTCCGGAGCGCCGTC
ATGAAGATATTCAACGTCGACGGCGCATACGGCAAACTGGTGATGCCAACGCCGCTTGACGAGGCCGCACTGACC
GTCGAGAACCGCACGGCGTACGACGACATGTCCATCGCCGACCGCCTCGCGCAGCTCGGGGACGGCCTGTCAGCG
GACGAGACGGCCGTCGTCTCCAGCTTCGTTGTCATGTGCACAGGGAGCCGGGCGATGGACGAGTGCAGCTTCTAC
GAGCTCCTGCACTGGTGGTGCCTGTGCGGCCACAGCCCGGACGCCTTCTTCCGCAACATCGGCGTCTACCAGCTG
CGGCGCGGCCAGTCCAGCCTGGCGCGGTGCATCTTCGACGACGCCCTCGGCTCCGGGCGGCTCGCGTACGCACTC
GGCACGCCAGTCGACGCTGTCCGCGACGGCCCCGACGCCGCGACGGTCCGCGCCGGCGCCGGCGGCCGGGCCTTC
CGGGCGAGGCGCGTCGTCTGCACCGTCCCGCTCAACACGCTCCGCCGCATTGCCTTCGACCCGCCCCTTCCGGCC
GACAAGCTGGCCGCGGCGGACACGAACCGCCGGAACGGCGGAGCCAAGATCAACTCCCGGTGCGCCGGCGCCGAC
CTCCGCTCGTGGACCTGTAGCGACCCGGACAACGGGCTGATTTGCTATTCATACGAGTCCGGCTCTGCCGCCGCC
GGCACCACTAATATCGTAGGCTTCGGCCAGTATCCCGAAGGCGAACTGGACGACGCGGCCGTGGGGGAGCGCTTC
GGGGCCTCGATACACGAGAGTTTGCGGCCACATGTCAAACAAATCGTTTTCCACAACTGGTCCCGGGACGAATAT
TCTAACGGATCTTGGTTTTTCCCCGGCCCGGGTTTGGTGACGAGGTATCTCGACGGCTTGCGGCGCGACCACGGA
AACGTGCTGTTCGCCAGCTCGGATTGGTCCACTGGCTGGCGCGGCTTCATCGACGGCGCCATGCAGGAGGGCGCT
CGGGCTGCGGCTGGCATCGTGAAGAGCCTACGGGTGGAGAGGCTATAG
Transcript >Hirsu2|3729
ATGTCGACCCGAGATGGCCGCAGCTGGATGCCCGGCGCGGGCCCGGAAGCAGACTTACCGTGTGTCGCCGCCATC
ACGCCCTCGTGTAATGTAGAACGGCATACTTCGCCCGAGCCCTTCGACGCCATCGTCATCGGCGCCGGCTACGCG
GGCCTCATCGCGGCCCGAGATCTGACCACGTCCGGCCTAAAGGTTCTCTTGCTGGACGGCCGGGATCGACTGGGA
GGCCGCGCCTGGTCCACGGATCTCGACGGCCATCCGTTCGAGATGGGTGGCAGCTATGTCTCCGACGTGCACCGA
CACGTCTGGCGCGAGATCACTCGCTATCAGCTCGGCGTCAAGGCCGGGCCGGAGCGCAAGGACGAGCAGAACAAA
GCGATCCTGATTCGGGATGGCGAGGAGCGCCATGCGTCCCAGGACGAAAGGAACCGACTGCTCCGGAGCGCCGTC
ATGAAGATATTCAACGTCGACGGCGCATACGGCAAACTGGTGATGCCAACGCCGCTTGACGAGGCCGCACTGACC
GTCGAGAACCGCACGGCGTACGACGACATGTCCATCGCCGACCGCCTCGCGCAGCTCGGGGACGGCCTGTCAGCG
GACGAGACGGCCGTCGTCTCCAGCTTCGTTGTCATGTGCACAGGGAGCCGGGCGATGGACGAGTGCAGCTTCTAC
GAGCTCCTGCACTGGTGGTGCCTGTGCGGCCACAGCCCGGACGCCTTCTTCCGCAACATCGGCGTCTACCAGCTG
CGGCGCGGCCAGTCCAGCCTGGCGCGGTGCATCTTCGACGACGCCCTCGGCTCCGGGCGGCTCGCGTACGCACTC
GGCACGCCAGTCGACGCTGTCCGCGACGGCCCCGACGCCGCGACGGTCCGCGCCGGCGCCGGCGGCCGGGCCTTC
CGGGCGAGGCGCGTCGTCTGCACCGTCCCGCTCAACACGCTCCGCCGCATTGCCTTCGACCCGCCCCTTCCGGCC
GACAAGCTGGCCGCGGCGGACACGAACCGCCGGAACGGCGGAGCCAAGATCAACTCCCGGTGCGCCGGCGCCGAC
CTCCGCTCGTGGACCTGTAGCGACCCGGACAACGGGCTGATTTGCTATTCATACGAGTCCGGCTCTGCCGCCGCC
GGCACCACTAATATCGTAGGCTTCGGCCAGTATCCCGAAGGCGAACTGGACGACGCGGCCGTGGGGGAGCGCTTC
GGGGCCTCGATACACGAGAGTTTGCGGCCACATGTCAAACAAATCGTTTTCCACAACTGGTCCCGGGACGAATAT
TCTAACGGATCTTGGTTTTTCCCCGGCCCGGGTTTGGTGACGAGGTATCTCGACGGCTTGCGGCGCGACCACGGA
AACGTGCTGTTCGCCAGCTCGGATTGGTCCACTGGCTGGCGCGGCTTCATCGACGGCGCCATGCAGGAGGGCGCT
CGGGCTGCGGCTGGCATCGTGAAGAGCCTACGGGTGGAGAGGCTATAG
Gene >Hirsu2|3729
ATGTCGACCCGAGATGGCCGCAGCTGGATGCCCGGCGCGGGCCCGGAAGCAGACTTACCGTGTGTCGCCGCCATC
ACGCCCTCGTGTAATGTAGAACGGCATACTTCGCCCGAGCCCTTCGACGCCATCGTCATCGGCGCCGGCTACGCG
GGCCTCATCGCGGCCCGAGATCTGACCACGTCCGGTGCGCCTGAAGCCCCCCGTCCCCTTCCCTCGGCGTTGCTT
TCTCGCTTGCTAAACTCGAACGTGCAGGCCTAAAGGTTCTCTTGCTGGACGGCCGGGATCGACTGGGAGGCCGCG
CCTGGTCCACGGATCTCGACGGCCATCCGTTCGAGATGGGTGGCAGCTATGTCTCCGACGTGCACCGACACGTCT
GGCGCGAGATCACTCGCTATCAGCTCGGCGTCAAGGCCGGGCCGGAGCGCAAGGACGAGCAGAACAAAGCGATCC
TGATTCGGGATGGCGAGGAGCGCCATGCGTCCCAGGACGAAAGGGTTCGTGTATTCGTGTCCCGCGTGAGCGCGC
CGAGAAAATACATGTACCTGGCTGACCGCAAGAGGGCCGGGCGCTCTCATGGGTTGCAGAACCGACTGCTCCGGA
GCGCCGTCATGAAGATATTCAACGTCGACGGCGCATACGGCAAACTGGTGATGCCAACGCCGCTTGACGAGGCCG
CACTGACCGTCGAGAACCGCACGGCGTACGACGACATGTCCATCGCCGACCGCCTCGCGCAGCTCGGGGACGGCC
TGTCAGCGGACGAGACGGCCGTCGTCTCCAGCTTCGTTGTCATGTGCACAGGGAGCCGGGCGATGGACGAGTGCA
GCTTCTACGAGCTCCTGCACTGGTGGTGCCTGTGCGGCCACAGCCCGGACGCCTTCTTCCGCAACATCGGCGTCT
ACCAGCTGCGGCGCGGCCAGTCCAGCCTGGCGCGGTGCATCTTCGACGACGCCCTCGGCTCCGGGCGGCTCGCGT
ACGCACTCGGCACGCCAGTCGACGCTGTCCGCGACGGCCCCGACGCCGCGACGGTCCGCGCCGGCGCCGGCGGCC
GGGCCTTCCGGGCGAGGCGCGTCGTCTGCACCGTCCCGCTCAACACGCTCCGCCGCATTGCCTTCGACCCGCCCC
TTCCGGCCGACAAGCTGGCCGCGGCGGACACGAACCGCCGGAACGGCGGAGCCAAGATCAACTCCCGGTGCGCCG
GCGCCGACCTCCGCTCGTGGACCTGTAGCGACCCGGACAACGGGCTGATTTGCTATTCATACGAGTCCGGCTCTG
CCGCCGCCGGCACCACTAATATCGTAGGCTTCGGCCAGTATCCCGAAGGCGAACTGGACGACGCGGCCGTGGGGG
AGCGCTTCGGGGCCTCGATACACGAGAGTTTGCGGCCACATGTCAAACAAATCGTCCGTTTACCCCATCCTCCCA
ATATATCCAAGCCCAGGGCTGACAAGCCACGACAACCAAAGGTTTTCCACAACTGGTCCCGGGACGAATATTCTA
ACGGATCTTGGTACGCTGTCCTCGAGCGCTCCTCAAACAAGCTTGTCGGCGAGGCATGTCACGCTGACCTGGCCT
GTCCGCTCCAGGTTTTTCCCCGGCCCGGGTTTGGTGACGAGGTATCTCGACGGCTTGCGGCGCGACCACGGAAAC
GTGCTGTTCGCCAGCTCGGATTGGTCCACTGGCTGGCGCGGCTTCATCGACGGCGCCATGCAGGAGGGCGCTCGG
GCTGCGGCTGGCATCGTGAAGAGCCTACGGGTGGAGAGGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail