Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3726
Gene name
LocationContig_2:63011..64476
Strand+
Gene length (bp)1465
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 1.2E-18 118 249
PF00190 Cupin_1 Cupin 2.1E-20 292 425
PF07883 Cupin_2 Cupin domain 1.1E-11 143 215
PF07883 Cupin_2 Cupin domain 7.2E-13 323 396

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 63 422 3.0E-148
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 67 424 7.0E-133
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 71 419 3.0E-90
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 71 419 1.0E-83
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 280 428 8.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 63 422 3.0E-148
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 67 424 7.0E-133
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 71 419 3.0E-90
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 71 419 1.0E-83
sp|O34714|OXDC_BACSU Oxalate decarboxylase OxdC OS=Bacillus subtilis (strain 168) GN=oxdC PE=1 SV=1 280 428 8.0E-16
sp|O34767|OXDD_BACSU Oxalate decarboxylase OxdD OS=Bacillus subtilis (strain 168) GN=oxdD PE=1 SV=1 121 269 7.0E-14
sp|D4B179|OXDC_ARTBC Oxalate decarboxylase ARB_02208 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02208 PE=1 SV=1 116 263 2.0E-11
sp|D4AKL6|OXDD_ARTBC Probable oxalate decarboxylase ARB_04859 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04859 PE=1 SV=1 105 261 3.0E-10
sp|Q6I544|GL52_ORYSJ Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0277500 PE=2 SV=1 318 438 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3726
MKLTAAQWLLVAGASLTSGLPSRDANSRRQRPLSTSGYDESSGTPYTPGHRDPYDSKVDPIGQNLDPLPWRNGHG
ASILGPYNRDRSRQSPDLVRPPSTDHGTIANMRWSFTDSHIRIEEGGWTRQTTVRELPTSVELAGVNMRLDSGVI
RELHWHKEAEWAYVLDGEVRVTAIDYDGGSFMDDLKKGDLWYFPSGVPHSLQGLGENGTEFLLIFDDGHFSEEST
FLLTDWLAHSPKSVVAENFRLHPQVLKKLPSREKYIFQGSRPGSIDEERPRGKHVKQSKYQFTHRMLDQEPKVTS
GGQVRVTDTTNFPISKTVSAAHAIIEPGALREMHWHPTADEWSFFIRGRARVTVFAAEGNARTFDYMPGDVGIVP
KNMGHFVENIGDEPVEMLEIFRSDRFRDFSLFQWMGETPRRLVADHLFANDEEAGRKFLERVKDAEKDEIRQT*
Coding >Hirsu2|3726
ATGAAACTCACCGCAGCCCAGTGGCTGCTCGTTGCCGGAGCCAGCCTCACCTCGGGCCTGCCTAGCCGTGATGCC
AACTCCCGCCGGCAACGGCCGCTCAGCACCTCCGGCTATGACGAGAGCTCCGGCACGCCTTATACGCCTGGCCAT
CGCGACCCCTACGACAGCAAGGTTGACCCAATCGGCCAGAACCTGGACCCCCTGCCCTGGCGCAACGGCCACGGA
GCCTCAATTCTCGGTCCCTACAACCGGGACCGCTCCCGCCAGAGCCCGGACCTGGTCCGTCCGCCCAGCACCGAC
CACGGCACCATTGCCAACATGAGATGGAGCTTTACCGACTCGCACATCCGTATCGAGGAGGGCGGCTGGACCCGG
CAGACCACGGTGCGTGAGCTCCCGACCAGCGTCGAGCTGGCCGGTGTCAACATGCGCCTCGACTCGGGCGTCATC
CGTGAGCTGCACTGGCACAAGGAGGCCGAATGGGCCTACGTGCTCGACGGCGAGGTCCGCGTCACCGCCATCGAC
TACGACGGCGGCAGCTTCATGGACGACCTCAAAAAGGGCGACCTCTGGTACTTTCCCAGCGGCGTCCCCCACTCG
CTGCAGGGCCTTGGCGAGAACGGCACCGAGTTCCTTCTCATCTTTGACGACGGCCACTTCTCCGAGGAGTCGACT
TTTCTGCTGACCGACTGGCTGGCTCACTCGCCCAAGTCGGTCGTGGCCGAAAACTTCCGTCTCCACCCTCAGGTC
CTGAAGAAGCTGCCGTCCCGCGAGAAATACATCTTCCAGGGCTCCCGCCCCGGCTCCATCGACGAGGAGCGGCCC
CGCGGCAAGCACGTCAAGCAGTCCAAGTACCAGTTCACCCACCGCATGCTCGACCAGGAGCCCAAGGTCACGAGC
GGCGGCCAGGTCCGCGTCACCGACACGACCAACTTCCCCATCTCCAAGACGGTCTCGGCCGCCCACGCCATCATC
GAGCCCGGCGCCCTGCGCGAGATGCACTGGCACCCCACGGCCGACGAGTGGTCCTTCTTCATCCGCGGCCGCGCC
CGCGTCACCGTCTTCGCCGCCGAGGGCAACGCCCGCACCTTTGACTACATGCCCGGCGACGTCGGCATCGTGCCC
AAGAACATGGGCCACTTTGTCGAGAACATCGGCGACGAGCCCGTCGAGATGCTCGAGATCTTCCGCTCCGACCGC
TTCCGCGACTTCTCCCTCTTCCAGTGGATGGGCGAGACGCCACGGCGGCTGGTCGCCGATCATCTCTTCGCCAAC
GACGAGGAGGCCGGCCGCAAGTTTCTGGAGCGGGTCAAGGACGCCGAAAAGGACGAGATCAGGCAGACCTAA
Transcript >Hirsu2|3726
ATGAAACTCACCGCAGCCCAGTGGCTGCTCGTTGCCGGAGCCAGCCTCACCTCGGGCCTGCCTAGCCGTGATGCC
AACTCCCGCCGGCAACGGCCGCTCAGCACCTCCGGCTATGACGAGAGCTCCGGCACGCCTTATACGCCTGGCCAT
CGCGACCCCTACGACAGCAAGGTTGACCCAATCGGCCAGAACCTGGACCCCCTGCCCTGGCGCAACGGCCACGGA
GCCTCAATTCTCGGTCCCTACAACCGGGACCGCTCCCGCCAGAGCCCGGACCTGGTCCGTCCGCCCAGCACCGAC
CACGGCACCATTGCCAACATGAGATGGAGCTTTACCGACTCGCACATCCGTATCGAGGAGGGCGGCTGGACCCGG
CAGACCACGGTGCGTGAGCTCCCGACCAGCGTCGAGCTGGCCGGTGTCAACATGCGCCTCGACTCGGGCGTCATC
CGTGAGCTGCACTGGCACAAGGAGGCCGAATGGGCCTACGTGCTCGACGGCGAGGTCCGCGTCACCGCCATCGAC
TACGACGGCGGCAGCTTCATGGACGACCTCAAAAAGGGCGACCTCTGGTACTTTCCCAGCGGCGTCCCCCACTCG
CTGCAGGGCCTTGGCGAGAACGGCACCGAGTTCCTTCTCATCTTTGACGACGGCCACTTCTCCGAGGAGTCGACT
TTTCTGCTGACCGACTGGCTGGCTCACTCGCCCAAGTCGGTCGTGGCCGAAAACTTCCGTCTCCACCCTCAGGTC
CTGAAGAAGCTGCCGTCCCGCGAGAAATACATCTTCCAGGGCTCCCGCCCCGGCTCCATCGACGAGGAGCGGCCC
CGCGGCAAGCACGTCAAGCAGTCCAAGTACCAGTTCACCCACCGCATGCTCGACCAGGAGCCCAAGGTCACGAGC
GGCGGCCAGGTCCGCGTCACCGACACGACCAACTTCCCCATCTCCAAGACGGTCTCGGCCGCCCACGCCATCATC
GAGCCCGGCGCCCTGCGCGAGATGCACTGGCACCCCACGGCCGACGAGTGGTCCTTCTTCATCCGCGGCCGCGCC
CGCGTCACCGTCTTCGCCGCCGAGGGCAACGCCCGCACCTTTGACTACATGCCCGGCGACGTCGGCATCGTGCCC
AAGAACATGGGCCACTTTGTCGAGAACATCGGCGACGAGCCCGTCGAGATGCTCGAGATCTTCCGCTCCGACCGC
TTCCGCGACTTCTCCCTCTTCCAGTGGATGGGCGAGACGCCACGGCGGCTGGTCGCCGATCATCTCTTCGCCAAC
GACGAGGAGGCCGGCCGCAAGTTTCTGGAGCGGGTCAAGGACGCCGAAAAGGACGAGATCAGGCAGACCTAA
Gene >Hirsu2|3726
ATGAAACTCACCGCAGCCCAGTGGCTGCTCGTTGCCGGAGCCAGCCTCACCTCGGGCCTGCCTAGCCGTGATGCC
AACTCCCGCCGGCAACGGCCGCTCAGCACCTCCGGCTATGACGAGAGCTCCGGCACGCCTTATACGCCTGGCCAT
CGCGACCCCTACGACAGCAAGGTTGACCCAATCGGCCAGAACCTGGACCCCCTGCCCTGGCGCAACGGCCACGGA
GCCTCAATTCTCGGTCCCTACAACCGGGACCGCTCCCGCCAGAGCCCGGACCTGGTCCGTCCGCCCAGCACCGAC
CACGGCACCATTGCCAACATGAGATGGAGCTTTACCGACTCGCACATCCGTATCGAGGTAAGCCCTCCTCGGTGG
AGAAGACGACGAGGCGAAACGAGAAAGACGCGGAGAGGGGGGGCGGGGAGAGCAAATGGGGATTGGGGCTCGAAA
CATGCTGACGCTCTTTTCCATCTAGGAGGGCGGCTGGACCCGGCAGACCACGGTGCGTGAGCTCCCGACCAGCGT
CGAGCTGGCCGGTGTCAACATGCGCCTCGACTCGGGCGTCATCCGTGAGCTGCACTGGCACAAGGAGGCCGAATG
GGCCTACGTGCTCGACGGCGAGGTCCGCGTCACCGCCATCGACTACGACGGCGGCAGCTTCATGGACGACCTCAA
AAAGGGCGACCTCTGGTACTTTCCCAGCGGCGTCCCCCACTCGCTGCAGGGCCTTGGCGAGAACGGCACCGAGTT
CCTTCTCATCTTTGACGACGGCCACTTCTCCGAGGAGTCGACTTTTCTGCTGACCGACTGGCTGGCTCACTCGCC
CAAGTCGGTCGTGGCCGAAAACTTCCGTCTCCACCCTCAGGTCCTGAAGAAGCTGCCGTCCCGCGAGAAATACAT
CTTCCAGGGCTCCCGCCCCGGCTCCATCGACGAGGAGCGGCCCCGCGGCAAGCACGTCAAGCAGTCCAAGTACCA
GTTCACCCACCGCATGCTCGACCAGGAGCCCAAGGTCACGAGCGGCGGCCAGGTCCGCGTCACCGACACGACCAA
CTTCCCCATCTCCAAGACGGTCTCGGCCGCCCACGCCATCATCGAGCCCGGCGCCCTGCGCGAGATGCACTGGCA
CCCCACGGCCGACGAGTGGTCCTTCTTCATCCGCGGCCGCGCCCGCGTCACCGTCTTCGCCGCCGAGGGCAACGC
CCGCACCTTTGACTACATGCCCGGCGACGTCGGCATCGTGCCCAAGAACATGGGCCACTTTGTCGAGAACATCGG
CGACGAGCCCGTCGAGATGCTCGAGATCTTCCGCTCCGACCGCTTCCGCGACTTCTCCCTCTTCCAGTGGATGGG
CGAGACGCCACGGCGGCTGGTCGCCGATCATCTCTTCGCCAACGACGAGGAGGCCGGCCGCAAGTTTCTGGAGCG
GGTCAAGGACGCCGAAAAGGACGAGATCAGGCAGACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail