Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3725
Gene name
LocationContig_2:60747..61671
Strand-
Gene length (bp)924
Transcript length (bp)828
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06912 DUF1275 Protein of unknown function (DUF1275) 2.1E-46 46 254

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

Domain # Start End Length
1 37 56 19
2 66 88 22
3 123 145 22
4 155 177 22
5 215 232 17
6 237 259 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3725
MSNSNGYTERAPLLGPKPASSSKALLARWRRRMTAEVSRSWADLVLLLCYVVTGLLDSASTQVWGAFVSMQTGNT
VYVGLGLASLVFPPTTPRLYRSGVSLLSFCVGSFLFARFHRFFSPKRRWVLCASFAAQAALTVAAAVIVANAPPA
SQDAVDWTVLLPLALVAFQSCAQAVTSRALRHNALTSVVLTSIYCDLFSDHDLFALRNVERNRRATAPLLLLVGA
VGGGLLSHSSFGISGALWTAAGLKFCMVVAWFFWPAEPEEDDQAGERAGR*
Coding >Hirsu2|3725
ATGAGCAACTCCAACGGCTACACCGAACGCGCGCCTCTGCTCGGCCCCAAGCCCGCGTCGTCGTCCAAGGCGCTG
CTGGCCCGATGGCGCCGCCGGATGACGGCTGAGGTGTCGCGCTCCTGGGCCGATCTTGTCTTGCTGCTCTGCTAC
GTCGTCACTGGCCTGCTGGACAGCGCGTCGACGCAGGTCTGGGGCGCCTTCGTCTCCATGCAAACAGGAAACACC
GTCTATGTCGGCCTCGGCCTCGCCTCTCTCGTCTTCCCGCCCACGACGCCCCGCCTGTACCGCTCCGGCGTCTCG
CTGCTCTCCTTCTGCGTCGGCTCCTTTCTCTTCGCCCGCTTCCACCGCTTCTTCTCCCCCAAGCGCCGCTGGGTC
CTGTGTGCCTCCTTCGCCGCGCAGGCGGCCCTGACCGTCGCCGCCGCCGTCATCGTAGCCAACGCGCCGCCCGCC
TCCCAGGACGCCGTCGACTGGACCGTCCTGCTGCCCCTCGCCCTCGTCGCCTTCCAGAGCTGCGCCCAGGCGGTG
ACGAGCAGGGCCCTCCGGCACAACGCGCTGACCAGCGTCGTCCTCACCAGCATCTACTGCGACCTGTTCTCCGAC
CACGACCTCTTTGCCCTCCGCAACGTCGAGAGGAACCGCCGCGCCACCGCGCCGCTGCTACTGCTCGTCGGCGCC
GTCGGCGGCGGGCTCCTGTCGCATAGCTCGTTCGGCATCAGCGGTGCGCTGTGGACCGCCGCCGGCCTCAAGTTC
TGCATGGTCGTCGCCTGGTTCTTCTGGCCCGCAGAACCCGAGGAAGACGACCAGGCTGGCGAGAGGGCAGGGAGA
TGA
Transcript >Hirsu2|3725
ATGAGCAACTCCAACGGCTACACCGAACGCGCGCCTCTGCTCGGCCCCAAGCCCGCGTCGTCGTCCAAGGCGCTG
CTGGCCCGATGGCGCCGCCGGATGACGGCTGAGGTGTCGCGCTCCTGGGCCGATCTTGTCTTGCTGCTCTGCTAC
GTCGTCACTGGCCTGCTGGACAGCGCGTCGACGCAGGTCTGGGGCGCCTTCGTCTCCATGCAAACAGGAAACACC
GTCTATGTCGGCCTCGGCCTCGCCTCTCTCGTCTTCCCGCCCACGACGCCCCGCCTGTACCGCTCCGGCGTCTCG
CTGCTCTCCTTCTGCGTCGGCTCCTTTCTCTTCGCCCGCTTCCACCGCTTCTTCTCCCCCAAGCGCCGCTGGGTC
CTGTGTGCCTCCTTCGCCGCGCAGGCGGCCCTGACCGTCGCCGCCGCCGTCATCGTAGCCAACGCGCCGCCCGCC
TCCCAGGACGCCGTCGACTGGACCGTCCTGCTGCCCCTCGCCCTCGTCGCCTTCCAGAGCTGCGCCCAGGCGGTG
ACGAGCAGGGCCCTCCGGCACAACGCGCTGACCAGCGTCGTCCTCACCAGCATCTACTGCGACCTGTTCTCCGAC
CACGACCTCTTTGCCCTCCGCAACGTCGAGAGGAACCGCCGCGCCACCGCGCCGCTGCTACTGCTCGTCGGCGCC
GTCGGCGGCGGGCTCCTGTCGCATAGCTCGTTCGGCATCAGCGGTGCGCTGTGGACCGCCGCCGGCCTCAAGTTC
TGCATGGTCGTCGCCTGGTTCTTCTGGCCCGCAGAACCCGAGGAAGACGACCAGGCTGGCGAGAGGGCAGGGAGA
TGA
Gene >Hirsu2|3725
ATGAGCAACTCCAACGGCTACACCGAACGCGCGCCTCTGCTCGGCCCCAAGCCCGCGTCGTCGTCCAAGGCGCTG
CTGGCCCGATGGCGCCGCCGGATGACGGCTGAGGTGTCGCGCTCCTGGGCCGATCTTGTCTTGCTGCTCTGCTAC
GTCGTCACTGGCCTGCTGGACAGCGCGTCGACGCAGGTCTGGGGCGCCTTCGTCTCCATGCAAACAGGTCCGATC
ACCCCTCTCCGCGTGTTACACAGCCGAGATGACGTCCGGCCCCCTTGCAGGCCTCGGCTCGCTCTGACTGTTGCT
GGACGAATCACAGGAAACACCGTCTATGTCGGCCTCGGCCTCGCCTCTCTCGTCTTCCCGCCCACGACGCCCCGC
CTGTACCGCTCCGGCGTCTCGCTGCTCTCCTTCTGCGTCGGCTCCTTTCTCTTCGCCCGCTTCCACCGCTTCTTC
TCCCCCAAGCGCCGCTGGGTCCTGTGTGCCTCCTTCGCCGCGCAGGCGGCCCTGACCGTCGCCGCCGCCGTCATC
GTAGCCAACGCGCCGCCCGCCTCCCAGGACGCCGTCGACTGGACCGTCCTGCTGCCCCTCGCCCTCGTCGCCTTC
CAGAGCTGCGCCCAGGCGGTGACGAGCAGGGCCCTCCGGCACAACGCGCTGACCAGCGTCGTCCTCACCAGCATC
TACTGCGACCTGTTCTCCGACCACGACCTCTTTGCCCTCCGCAACGTCGAGAGGAACCGCCGCGCCACCGCGCCG
CTGCTACTGCTCGTCGGCGCCGTCGGCGGCGGGCTCCTGTCGCATAGCTCGTTCGGCATCAGCGGTGCGCTGTGG
ACCGCCGCCGGCCTCAAGTTCTGCATGGTCGTCGCCTGGTTCTTCTGGCCCGCAGAACCCGAGGAAGACGACCAG
GCTGGCGAGAGGGCAGGGAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail