Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3719
Gene name
LocationContig_2:51307..53799
Strand-
Gene length (bp)2492
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.6E-70 97 401
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.5E-31 98 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94547|SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srk1 PE=1 SV=1 50 576 3.0E-164
sp|O42844|KCC2_SCHPO Calcium/calmodulin-dependent protein kinase type II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk2 PE=1 SV=1 89 410 1.0E-123
sp|P38623|RCK2_YEAST Serine/threonine-protein kinase RCK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCK2 PE=1 SV=3 96 534 4.0E-114
sp|P38622|RCK1_YEAST Serine/threonine-protein kinase RCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCK1 PE=3 SV=1 67 403 8.0E-85
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 94 410 3.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94547|SRK1_SCHPO Serine/threonine-protein kinase srk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srk1 PE=1 SV=1 50 576 3.0E-164
sp|O42844|KCC2_SCHPO Calcium/calmodulin-dependent protein kinase type II OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk2 PE=1 SV=1 89 410 1.0E-123
sp|P38623|RCK2_YEAST Serine/threonine-protein kinase RCK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCK2 PE=1 SV=3 96 534 4.0E-114
sp|P38622|RCK1_YEAST Serine/threonine-protein kinase RCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCK1 PE=3 SV=1 67 403 8.0E-85
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 94 410 3.0E-64
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 96 410 6.0E-64
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 94 464 1.0E-63
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 96 410 1.0E-63
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 96 479 2.0E-63
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 96 410 8.0E-63
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 96 479 1.0E-62
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 96 479 3.0E-62
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 98 410 2.0E-61
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 98 410 1.0E-60
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 98 410 2.0E-60
sp|P08414|KCC4_MOUSE Calcium/calmodulin-dependent protein kinase type IV OS=Mus musculus GN=Camk4 PE=1 SV=2 89 401 3.0E-59
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 96 401 5.0E-59
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 96 441 1.0E-58
sp|P13234|KCC4_RAT Calcium/calmodulin-dependent protein kinase type IV OS=Rattus norvegicus GN=Camk4 PE=1 SV=3 89 401 1.0E-58
sp|Q16566|KCC4_HUMAN Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens GN=CAMK4 PE=1 SV=1 96 401 5.0E-58
sp|Q86AD7|MYLKB_DICDI Probable myosin light chain kinase DDB_G0271550 OS=Dictyostelium discoideum GN=DDB_G0271550 PE=3 SV=1 96 401 4.0E-56
sp|Q54CY9|MYLKD_DICDI Probable myosin light chain kinase DDB_G0292624 OS=Dictyostelium discoideum GN=DDB_G0292624 PE=3 SV=1 96 426 1.0E-55
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 96 404 1.0E-54
sp|P39009|DUN1_YEAST DNA damage response protein kinase DUN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUN1 PE=1 SV=1 93 401 1.0E-53
sp|P34101|FHKC_DICDI Probable serine/threonine-protein kinase fhkC OS=Dictyostelium discoideum GN=fhkC PE=3 SV=2 94 401 2.0E-53
sp|Q54PB4|MYLKE_DICDI Probable myosin light chain kinase DDB_G0284661 OS=Dictyostelium discoideum GN=DDB_G0284661 PE=3 SV=1 96 419 4.0E-53
sp|Q869W6|MYLKG_DICDI Probable myosin light chain kinase DDB_G0275057 OS=Dictyostelium discoideum GN=DDB_G0275057 PE=3 SV=1 100 404 5.0E-52
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 102 414 2.0E-51
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 102 416 2.0E-51
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 94 432 4.0E-51
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 94 432 6.0E-51
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 94 431 6.0E-51
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 94 431 6.0E-51
sp|Q6PGN3|DCLK2_MOUSE Serine/threonine-protein kinase DCLK2 OS=Mus musculus GN=Dclk2 PE=1 SV=1 90 401 2.0E-50
sp|B4NSS9|DCLK_DROSI Serine/threonine-protein kinase GD17699 OS=Drosophila simulans GN=GD17699 PE=3 SV=1 60 400 3.0E-50
sp|D2I3C6|DCLK2_AILME Serine/threonine-protein kinase DCLK2 OS=Ailuropoda melanoleuca GN=DCLK2 PE=3 SV=1 93 401 4.0E-50
sp|B4IMC3|DCLK_DROSE Serine/threonine-protein kinase GM11705 OS=Drosophila sechellia GN=GM11705 PE=3 SV=1 96 400 6.0E-50
sp|Q5MPA9|DCLK2_RAT Serine/threonine-protein kinase DCLK2 OS=Rattus norvegicus GN=Dclk2 PE=1 SV=2 93 401 6.0E-50
sp|Q7PLI7|DCLK_DROME Serine/threonine-protein kinase CG17528 OS=Drosophila melanogaster GN=CG17528 PE=1 SV=1 96 400 2.0E-49
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 82 401 2.0E-49
sp|P22517|KCC2_YEAST Calcium/calmodulin-dependent protein kinase II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK2 PE=1 SV=2 102 403 2.0E-49
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 82 401 2.0E-49
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 94 431 3.0E-49
sp|Q8N568|DCLK2_HUMAN Serine/threonine-protein kinase DCLK2 OS=Homo sapiens GN=DCLK2 PE=2 SV=4 93 401 3.0E-49
sp|B3NKK1|DCLK_DROER Serine/threonine-protein kinase GG21441 OS=Drosophila erecta GN=GG21441 PE=3 SV=1 60 400 3.0E-49
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 82 401 3.0E-49
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 82 401 3.0E-49
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 82 401 3.0E-49
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 82 401 3.0E-49
sp|O08875|DCLK1_RAT Serine/threonine-protein kinase DCLK1 OS=Rattus norvegicus GN=Dclk1 PE=1 SV=1 94 415 4.0E-49
sp|Q00168|KCC2A_DROME Calcium/calmodulin-dependent protein kinase type II alpha chain OS=Drosophila melanogaster GN=CaMKII PE=1 SV=1 82 401 5.0E-49
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 81 401 6.0E-49
sp|O15075|DCLK1_HUMAN Serine/threonine-protein kinase DCLK1 OS=Homo sapiens GN=DCLK1 PE=1 SV=2 94 415 6.0E-49
sp|Q13554|KCC2B_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens GN=CAMK2B PE=1 SV=3 94 401 1.0E-48
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 94 401 2.0E-48
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 94 401 2.0E-48
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 127 410 2.0E-48
sp|B4IT27|DCLK_DROYA Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba GN=GE16371 PE=3 SV=2 96 400 3.0E-48
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 94 401 5.0E-48
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 94 401 5.0E-48
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 94 401 5.0E-48
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 94 401 5.0E-48
sp|B4GXC2|DCLK_DROPE Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis GN=GL21140 PE=3 SV=1 57 400 8.0E-48
sp|B5DK35|DCLK_DROPS Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura GN=GA29083 PE=3 SV=1 57 400 8.0E-48
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 94 401 9.0E-48
sp|Q9JLM8|DCLK1_MOUSE Serine/threonine-protein kinase DCLK1 OS=Mus musculus GN=Dclk1 PE=1 SV=1 94 405 1.0E-47
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 94 401 1.0E-47
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 94 401 1.0E-47
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 102 400 3.0E-47
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 94 401 3.0E-47
sp|A8WXF6|KCC2D_CAEBR Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis briggsae GN=unc-43 PE=3 SV=1 85 401 3.0E-47
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 95 412 6.0E-47
sp|O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II OS=Caenorhabditis elegans GN=unc-43 PE=1 SV=2 81 401 6.0E-47
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 90 401 7.0E-47
sp|Q13555|KCC2G_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens GN=CAMK2G PE=1 SV=3 81 422 1.0E-46
sp|Q1ZXC8|PXI_DICDI Probable serine/threonine-protein kinase pXi OS=Dictyostelium discoideum GN=pXi PE=2 SV=1 96 404 2.0E-46
sp|Q923T9|KCC2G_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Mus musculus GN=Camk2g PE=1 SV=1 81 422 2.0E-46
sp|P11730|KCC2G_RAT Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Rattus norvegicus GN=Camk2g PE=1 SV=1 81 422 4.0E-46
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 79 414 7.0E-46
sp|O14408|KCC1_METAN Calcium/calmodulin-dependent protein kinase OS=Metarhizium anisopliae PE=2 SV=1 90 407 8.0E-46
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 32 415 3.0E-45
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 98 405 3.0E-45
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 92 415 6.0E-45
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 93 408 2.0E-44
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 90 402 2.0E-44
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 13 416 2.0E-44
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 31 408 2.0E-44
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 12 401 2.0E-44
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 95 405 3.0E-44
sp|Q54W86|MYLKF_DICDI Probable myosin light chain kinase DDB_G0279831 OS=Dictyostelium discoideum GN=DDB_G0279831 PE=3 SV=1 95 405 4.0E-44
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 93 402 8.0E-44
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 12 401 1.0E-43
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 101 402 1.0E-43
sp|Q9NJU9|CDPK3_PLAF7 Calcium-dependent protein kinase 3 OS=Plasmodium falciparum (isolate 3D7) GN=CPK3 PE=1 SV=1 160 402 2.0E-43
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 17 417 2.0E-43
sp|Q3SYZ2|MAPK3_BOVIN MAP kinase-activated protein kinase 3 OS=Bos taurus GN=MAPKAPK3 PE=2 SV=1 171 419 2.0E-43
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 98 402 2.0E-43
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 96 401 2.0E-43
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 96 423 3.0E-43
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 96 401 3.0E-43
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 12 421 3.0E-43
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 102 406 3.0E-43
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 93 401 3.0E-43
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 93 409 4.0E-43
sp|Q7SY49|CAMKV_DANRE CaM kinase-like vesicle-associated protein OS=Danio rerio GN=camkv PE=2 SV=2 94 422 4.0E-43
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 94 445 7.0E-43
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 94 402 7.0E-43
sp|Q6AVM3|CCAMK_ORYSJ Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Oryza sativa subsp. japonica GN=CCAMK PE=2 SV=1 96 515 8.0E-43
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 95 401 8.0E-43
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 94 402 8.0E-43
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 17 411 1.0E-42
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 94 402 2.0E-42
sp|Q3UHL1|CAMKV_MOUSE CaM kinase-like vesicle-associated protein OS=Mus musculus GN=Camkv PE=1 SV=2 94 422 2.0E-42
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 96 403 2.0E-42
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 161 401 2.0E-42
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 77 417 2.0E-42
sp|Q63092|CAMKV_RAT CaM kinase-like vesicle-associated protein OS=Rattus norvegicus GN=Camkv PE=1 SV=1 94 422 2.0E-42
sp|Q8NCB2|CAMKV_HUMAN CaM kinase-like vesicle-associated protein OS=Homo sapiens GN=CAMKV PE=2 SV=2 94 422 2.0E-42
sp|Q3UMW7|MAPK3_MOUSE MAP kinase-activated protein kinase 3 OS=Mus musculus GN=Mapkapk3 PE=1 SV=2 171 419 2.0E-42
sp|Q66H84|MAPK3_RAT MAP kinase-activated protein kinase 3 OS=Rattus norvegicus GN=Mapkapk3 PE=2 SV=1 171 418 3.0E-42
sp|Q6GLS4|CAMKV_XENLA CaM kinase-like vesicle-associated protein OS=Xenopus laevis GN=camkv PE=2 SV=1 161 422 3.0E-42
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 17 411 3.0E-42
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 95 401 4.0E-42
sp|A0AAR7|CCAMK_LOTJA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lotus japonicus GN=CCAMK PE=1 SV=1 94 418 4.0E-42
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 95 401 5.0E-42
sp|Q43531|CCAMK_LILLO Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase OS=Lilium longiflorum GN=CCAMK PE=1 SV=1 96 401 5.0E-42
sp|Q7RAV5|CDPK3_PLAYO Calcium-dependent protein kinase 3 OS=Plasmodium yoelii yoelii GN=CPK3 PE=3 SV=1 160 402 6.0E-42
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 17 411 8.0E-42
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 161 411 1.0E-41
sp|Q9YGM4|CAMKV_TAKRU CaM kinase-like vesicle-associated protein OS=Takifugu rubripes GN=camkv PE=2 SV=1 94 422 2.0E-41
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 96 416 4.0E-41
sp|Q96QS6|KPSH2_HUMAN Serine/threonine-protein kinase H2 OS=Homo sapiens GN=PSKH2 PE=2 SV=1 93 413 5.0E-41
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 95 409 5.0E-41
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 93 517 6.0E-41
sp|Q16644|MAPK3_HUMAN MAP kinase-activated protein kinase 3 OS=Homo sapiens GN=MAPKAPK3 PE=1 SV=1 171 419 7.0E-41
sp|Q9DB30|PHKG2_MOUSE Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Mus musculus GN=Phkg2 PE=2 SV=2 160 408 2.0E-40
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 101 405 2.0E-40
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 88 403 4.0E-40
sp|P15735|PHKG2_HUMAN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Homo sapiens GN=PHKG2 PE=1 SV=1 102 408 4.0E-40
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 93 402 4.0E-40
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 66 406 4.0E-40
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 95 454 4.0E-40
sp|Q54BF0|FHKA_DICDI Probable serine/threonine-protein kinase fhkA OS=Dictyostelium discoideum GN=fhkA PE=3 SV=1 93 401 4.0E-40
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 102 405 4.0E-40
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 83 454 5.0E-40
sp|F1QGZ6|MELK_DANRE Maternal embryonic leucine zipper kinase OS=Danio rerio GN=melk PE=2 SV=1 93 408 5.0E-40
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 95 401 5.0E-40
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 88 402 5.0E-40
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 95 408 5.0E-40
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 93 415 6.0E-40
sp|Q75GK4|CIPK7_ORYSJ CBL-interacting protein kinase 7 OS=Oryza sativa subsp. japonica GN=CIPK7 PE=2 SV=1 91 404 7.0E-40
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 95 401 7.0E-40
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 75 403 7.0E-40
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 95 402 9.0E-40
sp|Q924X7|STK33_MOUSE Serine/threonine-protein kinase 33 OS=Mus musculus GN=Stk33 PE=1 SV=2 102 401 2.0E-39
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 39 405 2.0E-39
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 83 421 2.0E-39
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 95 404 2.0E-39
sp|P49139|MAPK2_RABIT MAP kinase-activated protein kinase 2 (Fragment) OS=Oryctolagus cuniculus GN=MAPKAPK2 PE=1 SV=2 171 419 2.0E-39
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 56 405 2.0E-39
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 51 405 2.0E-39
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 96 402 2.0E-39
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 95 408 2.0E-39
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 96 403 3.0E-39
sp|P49137|MAPK2_HUMAN MAP kinase-activated protein kinase 2 OS=Homo sapiens GN=MAPKAPK2 PE=1 SV=1 171 419 4.0E-39
sp|O08605|MKNK1_MOUSE MAP kinase-interacting serine/threonine-protein kinase 1 OS=Mus musculus GN=Mknk1 PE=1 SV=2 100 426 4.0E-39
sp|P31325|PHKG2_RAT Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Rattus norvegicus GN=Phkg2 PE=1 SV=1 160 408 5.0E-39
sp|P49136|MAPK2_CRILO MAP kinase-activated protein kinase 2 (Fragment) OS=Cricetulus longicaudatus GN=MAPKAPK2 PE=2 SV=1 171 419 6.0E-39
sp|P49138|MAPK2_MOUSE MAP kinase-activated protein kinase 2 OS=Mus musculus GN=Mapkapk2 PE=1 SV=2 171 419 6.0E-39
sp|Q2KJ16|PHKG2_BOVIN Phosphorylase b kinase gamma catalytic chain, liver/testis isoform OS=Bos taurus GN=PHKG2 PE=2 SV=1 160 413 8.0E-39
sp|Q2QMI0|CIPK4_ORYSJ CBL-interacting protein kinase 4 OS=Oryza sativa subsp. japonica GN=CIPK4 PE=2 SV=2 91 404 8.0E-39
sp|Q58D94|MKNK1_BOVIN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Bos taurus GN=MKNK1 PE=2 SV=2 100 426 9.0E-39
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 26 405 1.0E-38
sp|Q16816|PHKG1_HUMAN Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Homo sapiens GN=PHKG1 PE=2 SV=3 94 402 1.0E-38
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 94 401 1.0E-38
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 95 482 1.0E-38
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 75 403 1.0E-38
sp|P00518|PHKG1_RABIT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Oryctolagus cuniculus GN=PHKG1 PE=1 SV=2 155 402 1.0E-38
sp|Q4G050|MKNK1_RAT MAP kinase-interacting serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mknk1 PE=2 SV=1 100 426 2.0E-38
sp|Q6RET6|CCAMK_PEA Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase (Fragment) OS=Pisum sativum GN=SYM9 PE=1 SV=2 96 418 2.0E-38
sp|Q54YF2|AMPKA_DICDI 5'-AMP-activated serine/threonine-protein kinase catalytic subunit alpha OS=Dictyostelium discoideum GN=snfA PE=2 SV=1 96 406 2.0E-38
sp|Q14680|MELK_HUMAN Maternal embryonic leucine zipper kinase OS=Homo sapiens GN=MELK PE=1 SV=3 93 401 2.0E-38
sp|Q95QC4|DCLK_CAEEL Serine/threonine-protein kinase zyg-8 OS=Caenorhabditis elegans GN=zyg-8 PE=1 SV=1 89 401 3.0E-38
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 73 402 3.0E-38
sp|Q28GW8|MELK_XENTR Maternal embryonic leucine zipper kinase OS=Xenopus tropicalis GN=melk PE=2 SV=1 93 572 3.0E-38
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 102 401 4.0E-38
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 95 401 4.0E-38
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 93 406 4.0E-38
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 23 405 4.0E-38
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 95 481 4.0E-38
sp|Q91821|MELK_XENLA Maternal embryonic leucine zipper kinase OS=Xenopus laevis GN=melk PE=1 SV=2 93 414 4.0E-38
sp|Q66JF3|MKNK1_XENTR MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus tropicalis GN=mknk1 PE=2 SV=1 100 406 5.0E-38
sp|Q9XIW0|CIPK7_ARATH CBL-interacting serine/threonine-protein kinase 7 OS=Arabidopsis thaliana GN=CIPK7 PE=1 SV=1 93 412 5.0E-38
sp|Q6RET7|CCAMK_MEDTR Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 OS=Medicago truncatula GN=DMI3 PE=2 SV=1 94 515 5.0E-38
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 96 401 5.0E-38
sp|O94168|SNF1_CANTR Carbon catabolite-derepressing protein kinase OS=Candida tropicalis GN=SNF1 PE=3 SV=1 95 406 7.0E-38
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 93 404 7.0E-38
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 3 406 8.0E-38
sp|P52497|SNF1_CANAX Carbon catabolite-derepressing protein kinase OS=Candida albicans GN=SNF1 PE=2 SV=2 80 406 8.0E-38
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 91 403 8.0E-38
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 83 401 9.0E-38
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 83 401 9.0E-38
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 77 406 1.0E-37
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 93 402 1.0E-37
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 95 411 1.0E-37
sp|Q0VD22|STK33_BOVIN Serine/threonine-protein kinase 33 OS=Bos taurus GN=STK33 PE=2 SV=1 160 401 1.0E-37
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 96 408 1.0E-37
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 102 402 1.0E-37
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 157 401 1.0E-37
sp|Q9SUL7|CIPK4_ARATH CBL-interacting serine/threonine-protein kinase 4 OS=Arabidopsis thaliana GN=CIPK4 PE=1 SV=1 93 404 2.0E-37
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 96 408 2.0E-37
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 96 408 2.0E-37
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 92 401 3.0E-37
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 91 401 3.0E-37
sp|P49071|MAPK2_DROME MAP kinase-activated protein kinase 2 OS=Drosophila melanogaster GN=MAPk-Ak2 PE=2 SV=1 173 409 3.0E-37
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 91 403 3.0E-37
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 91 403 3.0E-37
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 157 408 4.0E-37
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 147 405 6.0E-37
sp|Q00372|SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNF1 PE=3 SV=2 96 416 6.0E-37
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 91 402 6.0E-37
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 147 405 6.0E-37
sp|Q9YGW0|MKNK1_XENLA MAP kinase-interacting serine/threonine-protein kinase 1 OS=Xenopus laevis GN=mknk1 PE=2 SV=2 100 475 7.0E-37
sp|Q5KQF5|CIPKM_ORYSJ CBL-interacting protein kinase 22 OS=Oryza sativa subsp. japonica GN=CIPK22 PE=2 SV=1 95 430 7.0E-37
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 40 403 8.0E-37
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 102 402 8.0E-37
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 93 402 9.0E-37
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 93 402 9.0E-37
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 91 401 9.0E-37
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 93 403 1.0E-36
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 91 401 1.0E-36
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 48 408 1.0E-36
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 83 401 1.0E-36
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 157 408 1.0E-36
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 94 402 1.0E-36
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 155 403 1.0E-36
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 93 402 1.0E-36
sp|Q02595|KPK2_PLAFK Probable serine/threonine-protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=PK2 PE=2 SV=1 96 401 1.0E-36
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 93 422 1.0E-36
sp|P13186|KIN2_YEAST Serine/threonine-protein kinase KIN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN2 PE=1 SV=3 92 401 2.0E-36
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 95 422 2.0E-36
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 85 407 2.0E-36
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 91 401 2.0E-36
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 95 402 2.0E-36
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 160 401 2.0E-36
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 92 405 2.0E-36
sp|Q07250|KCCS_MALDO Calcium/calmodulin-dependent serine/threonine-protein kinase OS=Malus domestica PE=2 SV=1 94 418 2.0E-36
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 78 412 2.0E-36
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 96 424 3.0E-36
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 95 401 3.0E-36
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 91 401 3.0E-36
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 95 404 3.0E-36
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 91 401 3.0E-36
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 95 412 4.0E-36
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 95 411 4.0E-36
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 93 402 4.0E-36
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 72 458 4.0E-36
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 94 432 5.0E-36
sp|Q9Y2K2|SIK3_HUMAN Serine/threonine-protein kinase SIK3 OS=Homo sapiens GN=SIK3 PE=1 SV=3 96 417 5.0E-36
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 93 402 6.0E-36
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 93 402 6.0E-36
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 157 408 6.0E-36
sp|P45894|AAPK1_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Caenorhabditis elegans GN=aak-1 PE=2 SV=2 100 436 6.0E-36
sp|P06782|SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF1 PE=1 SV=1 96 406 6.0E-36
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 82 402 8.0E-36
sp|Q02723|RKIN1_SECCE Carbon catabolite-derepressing protein kinase OS=Secale cereale GN=RKIN1 PE=2 SV=1 92 406 9.0E-36
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 88 402 9.0E-36
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 93 402 9.0E-36
sp|Q9M9V8|CDPKA_ARATH Calcium-dependent protein kinase 10 OS=Arabidopsis thaliana GN=CPK10 PE=1 SV=1 94 408 9.0E-36
sp|Q6P4S6|SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus GN=Sik3 PE=1 SV=3 96 417 1.0E-35
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 95 405 1.0E-35
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 96 403 1.0E-35
sp|O54992|MAPK5_MOUSE MAP kinase-activated protein kinase 5 OS=Mus musculus GN=Mapkapk5 PE=1 SV=1 165 404 1.0E-35
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 80 405 1.0E-35
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 95 402 1.0E-35
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 95 401 1.0E-35
sp|P07934|PHKG1_MOUSE Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Mus musculus GN=Phkg1 PE=1 SV=3 155 402 2.0E-35
sp|Q8IW41|MAPK5_HUMAN MAP kinase-activated protein kinase 5 OS=Homo sapiens GN=MAPKAPK5 PE=1 SV=2 170 404 2.0E-35
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 96 403 2.0E-35
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 157 449 2.0E-35
sp|P13286|PHKG1_RAT Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform OS=Rattus norvegicus GN=Phkg1 PE=2 SV=2 155 402 2.0E-35
sp|Q66I46|MKNK2_XENTR MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus tropicalis GN=mknk2 PE=2 SV=1 100 426 2.0E-35
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 96 402 2.0E-35
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 151 401 3.0E-35
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 95 463 3.0E-35
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 93 408 4.0E-35
sp|P53681|CRK_DAUCA CDPK-related protein kinase OS=Daucus carota GN=CRK PE=2 SV=1 94 405 4.0E-35
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 100 404 4.0E-35
sp|Q6P431|MKNK2_XENLA MAP kinase-interacting serine/threonine-protein kinase 2 OS=Xenopus laevis GN=mknk2 PE=2 SV=1 100 426 5.0E-35
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 135 404 5.0E-35
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 96 403 5.0E-35
sp|Q9BYT3|STK33_HUMAN Serine/threonine-protein kinase 33 OS=Homo sapiens GN=STK33 PE=1 SV=1 102 401 5.0E-35
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 82 402 5.0E-35
sp|Q0UY20|ATG1_PHANO Serine/threonine-protein kinase atg1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG1 PE=3 SV=2 95 411 6.0E-35
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 96 412 9.0E-35
sp|P93759|CDPKE_ARATH Calcium-dependent protein kinase 14 OS=Arabidopsis thaliana GN=CPK14 PE=2 SV=1 94 402 1.0E-34
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 94 404 1.0E-34
sp|Q6NLQ6|CDPKW_ARATH Calcium-dependent protein kinase 32 OS=Arabidopsis thaliana GN=CPK32 PE=1 SV=1 95 408 1.0E-34
sp|Q6NSM8|SIK3_DANRE Serine/threonine-protein kinase SIK3 homolog OS=Danio rerio GN=zgc:66101 PE=2 SV=1 77 412 1.0E-34
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 96 401 1.0E-34
sp|Q2LYK3|PLK4_DROPS Serine/threonine-protein kinase PLK4 OS=Drosophila pseudoobscura pseudoobscura GN=SAK PE=3 SV=1 93 402 1.0E-34
sp|B4HBU3|PLK4_DROPE Serine/threonine-protein kinase PLK4 OS=Drosophila persimilis GN=SAK PE=3 SV=1 93 402 1.0E-34
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 157 432 1.0E-34
sp|Q8CDB0|MKNK2_MOUSE MAP kinase-interacting serine/threonine-protein kinase 2 OS=Mus musculus GN=Mknk2 PE=1 SV=3 102 426 1.0E-34
sp|Q8W4I7|CDPKD_ARATH Calcium-dependent protein kinase 13 OS=Arabidopsis thaliana GN=CPK13 PE=1 SV=2 94 408 2.0E-34
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 96 402 2.0E-34
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 93 407 2.0E-34
sp|Q5U2N4|MKNK2_RAT MAP kinase-interacting serine/threonine-protein kinase 2 OS=Rattus norvegicus GN=Mknk2 PE=2 SV=1 102 426 2.0E-34
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 96 402 2.0E-34
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 100 417 2.0E-34
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 94 401 2.0E-34
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 93 401 2.0E-34
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 96 415 2.0E-34
sp|Q9SSF8|CDPKU_ARATH Calcium-dependent protein kinase 30 OS=Arabidopsis thaliana GN=CPK30 PE=1 SV=1 94 408 2.0E-34
sp|Q10292|MEK1_SCHPO Meiosis-specific serine/threonine-protein kinase mek1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mek1 PE=3 SV=1 90 401 3.0E-34
sp|Q19469|SAD1_CAEEL Serine/threonine kinase SAD-1 OS=Caenorhabditis elegans GN=sad-1 PE=1 SV=2 160 410 3.0E-34
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 94 390 3.0E-34
sp|Q9HBH9|MKNK2_HUMAN MAP kinase-interacting serine/threonine-protein kinase 2 OS=Homo sapiens GN=MKNK2 PE=1 SV=3 155 426 3.0E-34
sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 OS=Glycine max PE=1 SV=1 157 408 3.0E-34
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 96 402 3.0E-34
sp|Q9FIM9|CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana GN=CRK4 PE=2 SV=1 95 406 3.0E-34
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 95 401 3.0E-34
sp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana GN=CRK2 PE=1 SV=1 95 401 3.0E-34
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 95 401 4.0E-34
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 95 402 4.0E-34
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 96 408 6.0E-34
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 93 401 6.0E-34
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 93 404 6.0E-34
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 93 402 7.0E-34
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 100 401 7.0E-34
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 93 401 7.0E-34
sp|Q1ZXH2|FHKB_DICDI Probable serine/threonine-protein kinase fhkB OS=Dictyostelium discoideum GN=fhkB PE=3 SV=1 92 457 8.0E-34
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 95 517 8.0E-34
sp|Q54DF2|MRKA_DICDI Probable serine/threonine-protein kinase MARK-A OS=Dictyostelium discoideum GN=mrkA PE=3 SV=1 96 404 9.0E-34
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 91 401 1.0E-33
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 93 390 1.0E-33
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 102 401 1.0E-33
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 93 402 1.0E-33
sp|Q1DN93|ATG1_COCIM Serine/threonine-protein kinase ATG1 OS=Coccidioides immitis (strain RS) GN=ATG1 PE=3 SV=1 93 411 1.0E-33
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 100 417 1.0E-33
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 93 402 1.0E-33
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 93 405 1.0E-33
sp|A5A7I8|CDPK5_SOLTU Calcium-dependent protein kinase 5 OS=Solanum tuberosum GN=CPK5 PE=2 SV=1 94 408 1.0E-33
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 93 404 2.0E-33
sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 92 401 2.0E-33
sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 92 401 2.0E-33
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 100 405 2.0E-33
sp|O88764|DAPK3_RAT Death-associated protein kinase 3 OS=Rattus norvegicus GN=Dapk3 PE=1 SV=1 96 402 2.0E-33
sp|O54784|DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus GN=Dapk3 PE=1 SV=1 96 402 2.0E-33
sp|Q9BUB5|MKNK1_HUMAN MAP kinase-interacting serine/threonine-protein kinase 1 OS=Homo sapiens GN=MKNK1 PE=1 SV=1 100 426 2.0E-33
sp|O70589|CSKP_MOUSE Peripheral plasma membrane protein CASK OS=Mus musculus GN=Cask PE=1 SV=2 96 402 2.0E-33
sp|Q9H0K1|SIK2_HUMAN Serine/threonine-protein kinase SIK2 OS=Homo sapiens GN=SIK2 PE=1 SV=1 96 409 2.0E-33
sp|O14936|CSKP_HUMAN Peripheral plasma membrane protein CASK OS=Homo sapiens GN=CASK PE=1 SV=3 96 402 2.0E-33
sp|Q62915|CSKP_RAT Peripheral plasma membrane protein CASK OS=Rattus norvegicus GN=Cask PE=1 SV=1 96 402 2.0E-33
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 61 404 2.0E-33
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 92 427 2.0E-33
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 58 409 2.0E-33
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 93 390 2.0E-33
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 173 402 2.0E-33
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 94 403 3.0E-33
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 95 405 3.0E-33
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 96 401 3.0E-33
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 160 400 3.0E-33
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 93 404 3.0E-33
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 95 402 3.0E-33
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 93 401 3.0E-33
sp|Q8CFH6|SIK2_MOUSE Serine/threonine-protein kinase SIK2 OS=Mus musculus GN=Sik2 PE=1 SV=1 96 409 3.0E-33
sp|Q5RD00|AAPK2_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Pongo abelii GN=PRKAA2 PE=2 SV=1 96 418 4.0E-33
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 93 401 4.0E-33
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 95 401 4.0E-33
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 88 403 4.0E-33
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 93 404 4.0E-33
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 160 400 4.0E-33
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 96 408 4.0E-33
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 160 400 4.0E-33
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 93 401 4.0E-33
sp|Q8BRK8|AAPK2_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Mus musculus GN=Prkaa2 PE=1 SV=3 96 418 4.0E-33
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 61 390 5.0E-33
sp|Q66HE5|NUAK2_RAT NUAK family SNF1-like kinase 2 OS=Rattus norvegicus GN=Nuak2 PE=1 SV=1 95 401 5.0E-33
sp|B4J3F1|PLK4_DROGR Serine/threonine-protein kinase PLK4 OS=Drosophila grimshawi GN=SAK PE=3 SV=1 93 405 5.0E-33
sp|Q38873|CDPK7_ARATH Calcium-dependent protein kinase 7 OS=Arabidopsis thaliana GN=CPK7 PE=2 SV=1 95 408 6.0E-33
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 92 389 6.0E-33
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 88 401 6.0E-33
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 96 403 7.0E-33
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 96 455 7.0E-33
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 94 402 7.0E-33
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 94 403 7.0E-33
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 84 400 8.0E-33
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 96 408 8.0E-33
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 88 435 8.0E-33
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 95 421 9.0E-33
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 61 404 9.0E-33
sp|P13185|KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN1 PE=1 SV=3 92 408 9.0E-33
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 95 401 9.0E-33
sp|P54646|AAPK2_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Homo sapiens GN=PRKAA2 PE=1 SV=2 96 418 9.0E-33
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 93 404 1.0E-32
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 93 389 1.0E-32
sp|Q9SJ61|CDPKP_ARATH Calcium-dependent protein kinase 25 OS=Arabidopsis thaliana GN=CPK25 PE=2 SV=1 94 408 1.0E-32
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 96 406 1.0E-32
sp|Q28948|AAPK2_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Sus scrofa GN=PRKAA2 PE=2 SV=2 96 418 1.0E-32
sp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 1 OS=Oryza sativa subsp. japonica GN=CAMK1 PE=1 SV=1 95 404 1.0E-32
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 96 406 1.0E-32
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 96 407 1.0E-32
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 96 406 1.0E-32
sp|Q09137|AAPK2_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Rattus norvegicus GN=Prkaa2 PE=1 SV=1 96 418 2.0E-32
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 88 435 2.0E-32
sp|Q09136|AAPK1_PIG 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragments) OS=Sus scrofa GN=PRKAA1 PE=1 SV=2 160 406 2.0E-32
sp|Q24210|CSKP_DROME Peripheral plasma membrane protein CASK OS=Drosophila melanogaster GN=CASK PE=1 SV=4 96 436 2.0E-32
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 96 401 2.0E-32
sp|Q9QYZ4|SMOK1_MOUSE Sperm motility kinase 1 OS=Mus musculus GN=Smok1 PE=2 SV=1 95 412 2.0E-32
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 95 401 2.0E-32
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 93 402 2.0E-32
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 88 435 3.0E-32
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 88 435 3.0E-32
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 88 435 3.0E-32
sp|Q9QYZ6|SMK2A_MOUSE Sperm motility kinase 2A OS=Mus musculus GN=Smok2a PE=2 SV=1 95 412 3.0E-32
sp|Q6ZWH5|NEK10_HUMAN Serine/threonine-protein kinase Nek10 OS=Homo sapiens GN=NEK10 PE=2 SV=3 64 394 3.0E-32
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 93 407 3.0E-32
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 93 401 3.0E-32
sp|A7F0W2|ATG1_SCLS1 Serine/threonine-protein kinase ATG1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ATG1 PE=3 SV=1 92 408 4.0E-32
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 91 401 4.0E-32
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 92 435 4.0E-32
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 95 403 4.0E-32
sp|O13945|PPK9_SCHPO Protein kinase domain-containing protein ppk9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk9 PE=3 SV=1 96 407 4.0E-32
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 100 401 5.0E-32
sp|P53682|CDPK1_ORYSJ Calcium-dependent protein kinase isoform 1 OS=Oryza sativa subsp. japonica GN=SPK PE=2 SV=2 94 405 5.0E-32
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 91 401 5.0E-32
sp|Q8BZN4|NUAK2_MOUSE NUAK family SNF1-like kinase 2 OS=Mus musculus GN=Nuak2 PE=1 SV=2 95 401 5.0E-32
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 92 389 5.0E-32
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 96 406 6.0E-32
sp|G4SLH0|TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans GN=ttn-1 PE=1 SV=2 100 406 6.0E-32
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 91 401 6.0E-32
sp|A1CHL6|ATG1_ASPCL Serine/threonine-protein kinase atg1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg1 PE=3 SV=1 93 408 7.0E-32
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 93 404 7.0E-32
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 101 401 8.0E-32
sp|Q9FX86|CAMK8_ARATH CDPK-related kinase 8 OS=Arabidopsis thaliana GN=CRK8 PE=2 SV=1 94 403 8.0E-32
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 101 401 8.0E-32
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 101 401 8.0E-32
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 92 402 8.0E-32
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 93 389 1.0E-31
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 93 407 1.0E-31
sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 96 433 1.0E-31
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 102 406 1.0E-31
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 160 412 2.0E-31
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 53 401 2.0E-31
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 93 411 2.0E-31
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 87 417 2.0E-31
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 157 405 2.0E-31
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 69 402 2.0E-31
sp|Q52EB3|ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG1 PE=1 SV=1 101 406 2.0E-31
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 93 389 3.0E-31
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 75 401 3.0E-31
sp|Q0CLX3|ATG1_ASPTN Serine/threonine-protein kinase atg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg1 PE=3 SV=1 95 396 3.0E-31
sp|A7KAL2|ATG1_PENRW Serine/threonine-protein kinase atg1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg1 PE=3 SV=1 95 401 3.0E-31
sp|Q9LZW4|CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana GN=CIPK14 PE=1 SV=1 95 402 3.0E-31
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 93 402 3.0E-31
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 93 407 3.0E-31
sp|Q94C40|CIPKH_ARATH CBL-interacting serine/threonine-protein kinase 17 OS=Arabidopsis thaliana GN=CIPK17 PE=1 SV=1 95 402 4.0E-31
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 96 402 4.0E-31
sp|P87248|ATG1_COLLN Serine/threonine-protein kinase ATG1 OS=Colletotrichum lindemuthianum GN=ATG1 PE=3 SV=1 101 396 5.0E-31
sp|Q5BCU8|ATG1_EMENI Serine/threonine-protein kinase atg1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg1 PE=3 SV=1 96 408 5.0E-31
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 93 422 5.0E-31
sp|P53684|CDPKB_ORYSJ Calcium-dependent protein kinase isoform 11 OS=Oryza sativa subsp. japonica GN=CPK11 PE=2 SV=2 94 405 5.0E-31
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 94 402 5.0E-31
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 96 401 6.0E-31
sp|Q3ZDQ4|ATG1_PODAS Serine/threonine-protein kinase ATG1 OS=Podospora anserina GN=ATG1 PE=2 SV=1 74 408 6.0E-31
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 94 402 6.0E-31
sp|Q5REX1|SIK2_PONAB Serine/threonine-protein kinase SIK2 OS=Pongo abelii GN=SIK2 PE=2 SV=1 96 409 6.0E-31
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 94 402 6.0E-31
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 93 405 7.0E-31
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 94 402 7.0E-31
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 93 401 7.0E-31
sp|O88831|KKCC2_RAT Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus GN=Camkk2 PE=1 SV=1 158 408 7.0E-31
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 94 402 7.0E-31
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 91 402 7.0E-31
sp|Q2UGZ7|ATG1_ASPOR Serine/threonine-protein kinase atg1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg1 PE=3 SV=1 93 408 7.0E-31
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 92 403 8.0E-31
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 99 426 8.0E-31
sp|Q8C078|KKCC2_MOUSE Calcium/calmodulin-dependent protein kinase kinase 2 OS=Mus musculus GN=Camkk2 PE=1 SV=2 158 408 1.0E-30
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 93 401 1.0E-30
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 96 408 1.0E-30
sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 96 433 1.0E-30
sp|O74536|SNF1_SCHPO SNF1-like protein kinase ssp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssp2 PE=1 SV=1 100 406 1.0E-30
sp|Q96RR4|KKCC2_HUMAN Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens GN=CAMKK2 PE=1 SV=2 158 408 1.0E-30
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 70 394 1.0E-30
sp|Q9SG12|CAMK6_ARATH CDPK-related kinase 6 OS=Arabidopsis thaliana GN=CRK6 PE=1 SV=1 95 406 1.0E-30
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 92 402 1.0E-30
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 95 408 1.0E-30
sp|Q4WPF2|ATG1_ASPFU Serine/threonine-protein kinase atg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg1 PE=3 SV=1 95 406 1.0E-30
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 92 389 1.0E-30
sp|A1CX69|ATG1_NEOFI Serine/threonine-protein kinase atg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg1 PE=3 SV=1 95 406 2.0E-30
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 29 403 2.0E-30
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 92 403 2.0E-30
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 93 402 2.0E-30
sp|Q9SPK4|PPCK1_ARATH Phosphoenolpyruvate carboxylase kinase 1 OS=Arabidopsis thaliana GN=PPCK1 PE=1 SV=1 95 407 2.0E-30
sp|Q6VZ17|HUNKB_XENLA Hormonally up-regulated neu tumor-associated kinase homolog B (Fragment) OS=Xenopus laevis GN=hunk-b PE=2 SV=1 157 401 3.0E-30
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 91 402 3.0E-30
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 93 406 3.0E-30
sp|Q21017|KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans GN=kin-29 PE=1 SV=2 152 427 3.0E-30
sp|Q1PE17|CDPKI_ARATH Calcium-dependent protein kinase 18 OS=Arabidopsis thaliana GN=CPK18 PE=2 SV=1 95 405 3.0E-30
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 95 426 7.0E-26
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 95 426 7.0E-26
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 95 343 2.0E-25
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 95 389 9.0E-25
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 95 389 1.0E-24
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 95 426 1.0E-24
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 92 389 1.0E-24
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 95 401 2.0E-24
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 95 426 5.0E-24
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 81 422 7.0E-24
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 92 389 1.0E-23
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 92 389 1.0E-23
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 93 389 1.0E-23
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 96 426 2.0E-23
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 96 426 3.0E-23
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 92 389 4.0E-23
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 93 402 7.0E-23
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 95 401 9.0E-23
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 98 389 1.0E-21
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 69 333 7.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3719
MPINDRAMLVSEPLYGQPPPALKEPPDAYSEAPGDGQNRVAQAGHVVAHHVEPAQNLQAKAAVKTKRVDEAELKQ
LVAEENASKTKFPRYPGLERWELVEKMGDGAFSNVYRARDLQGNHDQVAIKVVRKYEMNSMQGNQHLHPDFKRPP
RAAERSNILKEVQIMRQLDHPNIVKLIEFSESKQYYYIVLELAPGGELFHQIVRLTYFSEELSRHVIVRVAKALE
YLHEEKGVVHRDIKPENILFNPIPFVPSKHPRPKQPGDEDKVDEGEYIPGHGAGGIGEIKIADFGLSKIVWESQT
MTPCGTVGYTAPEIVKDERYSKSVDMWALGCVLYTLLCGFPPFYDESIEVLTEKVAKGQYTFLSPWWDDISGSAK
DLITHLLTVDPEKRYTIREFLAHPWIRASGPTPRDERRKSEVLRAVDMTKFEESGKRYDFRSPGAVNLREVFDVS
YAVHRQEEEGKMRQQLGTRAGGGKPLAGLHEEEEDEDRMQIDQGPGQKPNVATQALEQSMRKTNIRDQDAARVGR
EPHRANDKGYGQHSAAVTAAARQQVRDRNRQKGPFELNLDNATLLGKRGKKVPVMGA*
Coding >Hirsu2|3719
ATGCCCATAAACGACAGGGCCATGCTCGTCTCGGAGCCTCTCTACGGCCAGCCGCCGCCCGCGCTCAAGGAGCCC
CCCGATGCCTACTCGGAGGCCCCAGGTGATGGCCAGAACCGCGTCGCCCAGGCCGGCCACGTCGTCGCCCATCAC
GTCGAGCCTGCCCAGAACCTCCAGGCCAAGGCGGCCGTCAAGACCAAGCGCGTCGACGAGGCGGAGCTTAAGCAG
CTCGTCGCCGAGGAGAATGCCAGCAAGACGAAATTCCCCCGCTACCCCGGCCTCGAGAGATGGGAGCTGGTCGAG
AAGATGGGCGACGGCGCCTTCAGCAACGTCTACCGTGCCCGCGACCTGCAGGGCAACCATGACCAAGTCGCCATC
AAGGTTGTCCGCAAGTACGAGATGAACAGTATGCAGGGGAACCAGCATTTACATCCGGACTTCAAGAGGCCGCCC
AGAGCTGCAGAGCGATCCAATATCCTCAAAGAGGTGCAGATCATGCGCCAGCTCGATCACCCCAACATTGTCAAG
CTCATCGAGTTTTCCGAGTCGAAGCAGTACTACTACATTGTCCTCGAGCTCGCGCCCGGCGGTGAGCTGTTCCAC
CAGATCGTCCGCCTCACCTACTTCAGCGAGGAGCTTTCGCGGCACGTCATCGTCCGGGTGGCCAAGGCCCTCGAG
TACCTCCACGAGGAAAAGGGCGTCGTTCACCGCGACATCAAGCCCGAAAACATCCTCTTCAACCCCATACCCTTT
GTGCCGTCCAAGCACCCGAGGCCCAAGCAGCCCGGCGACGAGGACAAGGTCGATGAGGGCGAGTACATCCCCGGC
CATGGCGCCGGCGGCATTGGCGAGATCAAGATCGCCGACTTCGGTCTCTCCAAAATCGTGTGGGAGAGCCAAACC
ATGACACCGTGCGGCACCGTCGGCTACACGGCTCCCGAGATCGTCAAGGACGAGCGTTACTCCAAGTCGGTCGAT
ATGTGGGCCCTCGGCTGCGTCTTGTACACGCTGCTCTGCGGCTTCCCGCCCTTCTACGACGAGAGCATCGAGGTG
CTCACGGAAAAGGTGGCCAAGGGCCAGTACACCTTCCTGTCGCCTTGGTGGGACGACATCTCCGGCTCGGCCAAG
GATCTCATCACCCATCTCCTGACCGTCGACCCCGAGAAGCGCTACACGATCCGCGAGTTCCTCGCCCACCCCTGG
ATCCGGGCCAGTGGTCCCACCCCGCGAGACGAGAGGAGGAAGTCCGAGGTGCTGCGGGCCGTCGACATGACCAAG
TTCGAAGAGTCCGGCAAGCGCTACGACTTCCGTTCCCCCGGCGCCGTCAATCTCCGCGAGGTCTTTGACGTCAGC
TACGCCGTCCACCGCCAGGAAGAAGAAGGCAAGATGCGGCAGCAGCTGGGCACCCGGGCCGGGGGTGGAAAGCCT
CTGGCCGGCCTGCACGAGGAGGAAGAGGACGAGGATCGTATGCAGATCGACCAGGGCCCCGGGCAGAAACCAAAC
GTCGCGACACAGGCCCTGGAGCAGAGCATGCGCAAGACCAACATCCGCGACCAAGACGCCGCCAGGGTGGGCCGC
GAGCCGCACCGCGCCAACGACAAGGGCTACGGACAGCACTCGGCCGCCGTGACGGCAGCTGCTCGACAGCAAGTC
CGAGACCGAAATCGGCAGAAGGGGCCCTTCGAGCTCAACCTCGACAACGCGACACTGCTGGGCAAGCGTGGCAAG
AAAGTGCCCGTCATGGGGGCGTAG
Transcript >Hirsu2|3719
ATGCCCATAAACGACAGGGCCATGCTCGTCTCGGAGCCTCTCTACGGCCAGCCGCCGCCCGCGCTCAAGGAGCCC
CCCGATGCCTACTCGGAGGCCCCAGGTGATGGCCAGAACCGCGTCGCCCAGGCCGGCCACGTCGTCGCCCATCAC
GTCGAGCCTGCCCAGAACCTCCAGGCCAAGGCGGCCGTCAAGACCAAGCGCGTCGACGAGGCGGAGCTTAAGCAG
CTCGTCGCCGAGGAGAATGCCAGCAAGACGAAATTCCCCCGCTACCCCGGCCTCGAGAGATGGGAGCTGGTCGAG
AAGATGGGCGACGGCGCCTTCAGCAACGTCTACCGTGCCCGCGACCTGCAGGGCAACCATGACCAAGTCGCCATC
AAGGTTGTCCGCAAGTACGAGATGAACAGTATGCAGGGGAACCAGCATTTACATCCGGACTTCAAGAGGCCGCCC
AGAGCTGCAGAGCGATCCAATATCCTCAAAGAGGTGCAGATCATGCGCCAGCTCGATCACCCCAACATTGTCAAG
CTCATCGAGTTTTCCGAGTCGAAGCAGTACTACTACATTGTCCTCGAGCTCGCGCCCGGCGGTGAGCTGTTCCAC
CAGATCGTCCGCCTCACCTACTTCAGCGAGGAGCTTTCGCGGCACGTCATCGTCCGGGTGGCCAAGGCCCTCGAG
TACCTCCACGAGGAAAAGGGCGTCGTTCACCGCGACATCAAGCCCGAAAACATCCTCTTCAACCCCATACCCTTT
GTGCCGTCCAAGCACCCGAGGCCCAAGCAGCCCGGCGACGAGGACAAGGTCGATGAGGGCGAGTACATCCCCGGC
CATGGCGCCGGCGGCATTGGCGAGATCAAGATCGCCGACTTCGGTCTCTCCAAAATCGTGTGGGAGAGCCAAACC
ATGACACCGTGCGGCACCGTCGGCTACACGGCTCCCGAGATCGTCAAGGACGAGCGTTACTCCAAGTCGGTCGAT
ATGTGGGCCCTCGGCTGCGTCTTGTACACGCTGCTCTGCGGCTTCCCGCCCTTCTACGACGAGAGCATCGAGGTG
CTCACGGAAAAGGTGGCCAAGGGCCAGTACACCTTCCTGTCGCCTTGGTGGGACGACATCTCCGGCTCGGCCAAG
GATCTCATCACCCATCTCCTGACCGTCGACCCCGAGAAGCGCTACACGATCCGCGAGTTCCTCGCCCACCCCTGG
ATCCGGGCCAGTGGTCCCACCCCGCGAGACGAGAGGAGGAAGTCCGAGGTGCTGCGGGCCGTCGACATGACCAAG
TTCGAAGAGTCCGGCAAGCGCTACGACTTCCGTTCCCCCGGCGCCGTCAATCTCCGCGAGGTCTTTGACGTCAGC
TACGCCGTCCACCGCCAGGAAGAAGAAGGCAAGATGCGGCAGCAGCTGGGCACCCGGGCCGGGGGTGGAAAGCCT
CTGGCCGGCCTGCACGAGGAGGAAGAGGACGAGGATCGTATGCAGATCGACCAGGGCCCCGGGCAGAAACCAAAC
GTCGCGACACAGGCCCTGGAGCAGAGCATGCGCAAGACCAACATCCGCGACCAAGACGCCGCCAGGGTGGGCCGC
GAGCCGCACCGCGCCAACGACAAGGGCTACGGACAGCACTCGGCCGCCGTGACGGCAGCTGCTCGACAGCAAGTC
CGAGACCGAAATCGGCAGAAGGGGCCCTTCGAGCTCAACCTCGACAACGCGACACTGCTGGGCAAGCGTGGCAAG
AAAGTGCCCGTCATGGGGGCGTAG
Gene >Hirsu2|3719
ATGGTACGTAACCTCGTCCTCCCTCGCCCCCCCTTGCGGCCTCATATCAATCGCAGCCGCCCCGTCGCACTCAAT
CTGCGCCGTCTTATCTGACTCGTCACCCCCCTCCCTCTTTCTCTAGGTAAGCAAGCGCGAGTCACAAATCTCAGT
GAAGAGCCCCCACGCCAGGCCGCGCCGCTGCCTCCCCACGCACCGCAGCCCATAAACGACAGGGCCATGCTCGTC
TCGGAGCCTCTCTACGGCCAGCCGCCGCCCGCGCTCAAGGAGCCCCCCGATGCCTACTCGGAGGCCCCAGGTGAT
GGCCAGAACCGCGTCGCCCAGGCCGGCCACGTCGTCGCCCATCACGTCGAGCCTGCCCAGAACCTCCAGGCCAAG
GCGGCCGTCAAGACCAAGCGCGTCGACGAGGCGGAGCTTAAGCAGCTCGTCGCCGAGGAGAATGCCAGCAAGACG
AAATTCCCCCGCTACCCCGGCCTCGAGAGATGGGAGCTGGTCGAGAAGATGGGCGACGGCGCCTTCAGCAACGTC
TACCGTGCCCGCGACCTGCAGGGCAACCATGACCAAGTCGCCATCAAGGTTGTCCGCAAGTACGAGATGAACAGT
ATGCAGGTGAGTTACTCTCGGGCGGCGGCGCCGTCCGCGCTGCTCGCTCTCTTTCTCTTTGTCCACTTGTCTGCT
TGTCTGTTTCGCTGCCCTTGGTCTGCCTTTCTAGTTGTCCTGTTTCGAGTCTGCCCTTCTTGGTTTCTCCTTCGT
CTGCCGCGCAATGCTTCATGCACCCCCTTCTTGTCCTGCCTAGCGTTCCGACCTCGAAAGAGGGGCTCATCCCTA
AAATAGGGGAACCAGCATTTACATCCGGACTTCAAGAGGCCGCCCAGAGCTGCAGAGGTGCGAGAAACTCTTTTT
CCTTGTGTCCGGCCATTTCCCGTGCGCCGTCACGTTCTGCCTTGCTGCTGCTGCTGCTGCTCGTTCCGTTGCTTT
GAAACTGCGGCTTGTGCCTTGTTTTCGCGCCGCCGCCCGCCATCGCACCAGACGCCGAGGCTAACTCTCATGTAG
CGATCCAATATCCTCAAAGAGGTGCAGATCATGCGCCAGCTCGATCACCCCAACATTGTCAAGCTCATCGAGTTT
TCCGAGTCGAAGCAGTACTACTACATTGTCCTCGAGCTCGCGCCCGGCGGTGAGCTGTTCCACCAGATCGTCCGC
CTCACCTACTTCAGCGAGGAGCTTTCGCGGCACGTCATCGTCCGGGTGGCCAAGGCCCTCGAGTACCTCCACGAG
GAAAAGGGCGTCGTTCACCGGTACGGGCTCCGCAATTGTTGCCATCTCCTTTGTTCCCAGTCTCAATCTCGCTCC
CCCACCTCCACCCCCTGACGCCCGACGCCTGACGCCTGACGTCATCGCGCTCGGCTCTCGGTTGGTTGCATCGTG
GCTGACGATGATGCGTCATCAACAGCGACATCAAGCCCGAAAACATCCTCTTCAACCCCATACCCTTTGTGCCGT
CCAAGCACCCGAGGCCCAAGCAGCCCGGCGACGAGGACAAGGTCGATGAGGGCGAGTACATCCCCGGCCATGGCG
CCGGCGGCATTGGCGAGATCAAGATCGCCGACTTCGGTCTCTCCAAAATCGTGTGGGAGAGCCAAACCATGACAC
CGTGCGGCACCGTCGGCTACACGGCTCCCGAGATCGTCAAGGACGAGCGTTACTCCAAGTCGGTCGATATGTGGG
CCCTCGGCTGCGTCTTGTACACGCTGCTCTGCGGCTTCCCGCCCTTCTACGACGAGAGCATCGAGGTGCTCACGG
AAAAGGTGGCCAAGGGCCAGTACACCTTCCTGTCGCCTTGGTGGGACGACATCTCCGGCTCGGCCAAGGATCTCA
TCACCCATCTCCTGACCGTCGACCCCGAGAAGCGCTACACGATCCGCGAGTTCCTCGCCCACCCCTGGATCCGGG
CCAGTGGTCCCACCCCGCGAGACGAGAGGAGGAAGTCCGAGGTGCTGCGGGCCGTCGACATGACCAAGTTCGAAG
AGTCCGGCAAGCGCTACGACTTCCGTTCCCCCGGCGCCGTCAATCTCCGCGAGGTCTTTGACGTCAGCTACGCCG
TCCACCGCCAGGAAGAAGAAGGCAAGATGCGGCAGCAGCTGGGCACCCGGGCCGGGGGTGGAAAGCCTCTGGCCG
GCCTGCACGAGGAGGAAGAGGACGAGGATCGTATGCAGATCGACCAGGGCCCCGGGCAGAAACCAAACGTCGCGA
CACAGGCCCTGGAGCAGAGCATGCGCAAGACCAACATCCGCGACCAAGACGCCGCCAGGGTGGGCCGCGAGCCGC
ACCGCGCCAACGACAAGGGCTACGGACAGCACTCGGCCGCCGTGACGGCAGCTGCTCGACAGCAAGTCCGAGACC
GAAATCGGCAGAAGGGGCCCTTCGAGCTCAACCTCGACAACGCGACACTGCTGGGCAAGCGTGGCAAGAAAGTGC
CCGTCATGGGGGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail