Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3710
Gene name
LocationContig_2:31725..32623
Strand+
Gene length (bp)898
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04145 Ctr Ctr copper transporter family 1.3E-39 56 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94722|CTR4_SCHPO Copper transport protein ctr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr4 PE=1 SV=1 50 214 1.0E-29
sp|Q06686|CTR3_YEAST Copper transport protein CTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR3 PE=1 SV=1 41 199 3.0E-22
sp|Q9P7F9|CTR5_SCHPO Copper transport protein ctr5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr5 PE=1 SV=1 52 198 3.0E-16
sp|Q9USV7|CTR6_SCHPO Copper transport protein ctr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr6 PE=1 SV=1 41 190 2.0E-09
sp|O15431|COPT1_HUMAN High affinity copper uptake protein 1 OS=Homo sapiens GN=SLC31A1 PE=1 SV=1 1 197 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94722|CTR4_SCHPO Copper transport protein ctr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr4 PE=1 SV=1 50 214 1.0E-29
sp|Q06686|CTR3_YEAST Copper transport protein CTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTR3 PE=1 SV=1 41 199 3.0E-22
sp|Q9P7F9|CTR5_SCHPO Copper transport protein ctr5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr5 PE=1 SV=1 52 198 3.0E-16
sp|Q9USV7|CTR6_SCHPO Copper transport protein ctr6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctr6 PE=1 SV=1 41 190 2.0E-09
sp|O15431|COPT1_HUMAN High affinity copper uptake protein 1 OS=Homo sapiens GN=SLC31A1 PE=1 SV=1 1 197 2.0E-08
sp|Q5RAS6|COPT1_PONAB High affinity copper uptake protein 1 OS=Pongo abelii GN=SLC31A1 PE=2 SV=1 44 197 5.0E-08
sp|Q8K211|COPT1_MOUSE High affinity copper uptake protein 1 OS=Mus musculus GN=Slc31a1 PE=2 SV=1 32 197 8.0E-08
sp|Q8WNR0|COPT1_PIG High affinity copper uptake protein 1 OS=Sus scrofa GN=SLC31A1 PE=2 SV=1 18 197 1.0E-07
sp|Q9JK41|COPT1_RAT High affinity copper uptake protein 1 OS=Rattus norvegicus GN=Slc31a1 PE=2 SV=1 54 197 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035434 copper ion transmembrane transport Yes
GO:0005375 copper ion transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport No
GO:0044425 membrane part No
GO:0098660 inorganic ion transmembrane transport No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0006825 copper ion transport No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0000041 transition metal ion transport No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0046873 metal ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0006812 cation transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 174 196 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3710
MDHGDHGAMGHAGHGGGHAGHGSAGSHAGMDHSGAGSHAGMDHGGHGGMGGCKISMLFNLNTIDSCFLSDRWRIT
SAGMFAGSCIGVFLLGMTLEFLRRSVKEYDRFLVRQHRAKFAAAAAEGSSVSSKDGAAPSPRAPAPPPFRPGLVQ
QAVRAFLHLLQFVCAYILMLLAMYYNGYIILCIFLGAFFGAFIFQWETLRFGGQQTSAAEEATVCCG*
Coding >Hirsu2|3710
ATGGATCACGGCGACCACGGAGCCATGGGCCACGCCGGCCACGGGGGAGGCCACGCCGGCCACGGCAGCGCCGGG
AGCCATGCCGGCATGGACCACAGCGGCGCCGGAAGCCATGCCGGCATGGACCACGGCGGCCACGGCGGCATGGGA
GGCTGCAAGATCTCGATGCTCTTCAACCTCAACACCATCGACTCGTGCTTCCTCTCGGACCGCTGGCGCATCACC
TCGGCCGGCATGTTCGCCGGCTCCTGCATCGGCGTCTTCCTCCTCGGCATGACCCTCGAGTTCCTCCGCCGCTCC
GTCAAGGAGTACGACCGGTTCCTCGTCCGCCAGCACCGGGCCAAGTTCGCCGCCGCCGCCGCCGAGGGCAGCTCC
GTCAGCAGCAAGGACGGCGCCGCGCCCTCGCCCCGTGCCCCCGCCCCGCCGCCCTTCCGCCCCGGCCTTGTGCAG
CAGGCGGTCCGCGCCTTTCTGCACCTGCTGCAGTTCGTCTGTGCCTACATCCTCATGCTGCTCGCCATGTACTAC
AACGGCTATATCATCCTCTGCATCTTCCTCGGCGCTTTTTTCGGAGCCTTCATCTTCCAGTGGGAGACTCTGCGT
TTCGGGGGTCAGCAGACGAGTGCGGCGGAGGAAGCCACCGTCTGTTGCGGCTAG
Transcript >Hirsu2|3710
ATGGATCACGGCGACCACGGAGCCATGGGCCACGCCGGCCACGGGGGAGGCCACGCCGGCCACGGCAGCGCCGGG
AGCCATGCCGGCATGGACCACAGCGGCGCCGGAAGCCATGCCGGCATGGACCACGGCGGCCACGGCGGCATGGGA
GGCTGCAAGATCTCGATGCTCTTCAACCTCAACACCATCGACTCGTGCTTCCTCTCGGACCGCTGGCGCATCACC
TCGGCCGGCATGTTCGCCGGCTCCTGCATCGGCGTCTTCCTCCTCGGCATGACCCTCGAGTTCCTCCGCCGCTCC
GTCAAGGAGTACGACCGGTTCCTCGTCCGCCAGCACCGGGCCAAGTTCGCCGCCGCCGCCGCCGAGGGCAGCTCC
GTCAGCAGCAAGGACGGCGCCGCGCCCTCGCCCCGTGCCCCCGCCCCGCCGCCCTTCCGCCCCGGCCTTGTGCAG
CAGGCGGTCCGCGCCTTTCTGCACCTGCTGCAGTTCGTCTGTGCCTACATCCTCATGCTGCTCGCCATGTACTAC
AACGGCTATATCATCCTCTGCATCTTCCTCGGCGCTTTTTTCGGAGCCTTCATCTTCCAGTGGGAGACTCTGCGT
TTCGGGGGTCAGCAGACGAGTGCGGCGGAGGAAGCCACCGTCTGTTGCGGCTAG
Gene >Hirsu2|3710
ATGGATCACGGCGACCACGGAGCCATGGGCCACGCCGGCCACGGGGGAGGCCACGCCGGCCACGGCAGCGCCGGG
AGCCATGCCGGCATGGACCACAGCGGCGCCGGAAGCCATGCCGGCATGGACCACGGCGGCCACGGCGGCATGGGA
GGCTGCAAGATCTCGGTACGCCGTCTTCGCCCCTGCCCCCCCTGACCGGACACCGACTGACGGCTTGCAGATGCT
CTTCAACCTCAACACCATCGACTCGTGCTTCCTCTCGGACCGCTGGCGCATCACCTCGGCCGGCATGTTCGCCGG
CTCCTGCATCGGCGTCTTCCTCCTCGGCATGACCCTCGAGTTCCTCCGCCGCTCCGTCAAGGAGTACGACCGGTT
CCTCGTCCGCCAGCACCGGGCCAAGTTCGCCGCCGCCGCCGCCGAGGGCAGCTCCGTCAGCAGCAAGGACGGCGC
CGCGCCCTCGCCCCGTGCCCCCGCCCCGCCGCCCTTCCGCCCCGGCCTTGTGCAGCAGGCGGTCCGCGCCTTTCT
GCACCTGCTGCAGTTCGTCTGTGCCTACATCCTCATGCTGGTCCGTTTGCACCCGTGCTTCGGCACCCCCGTCTC
TTTCCTCGGGGGAAGGTTTCTGTGACGGGCTCGGAGAAAGGCTGATGGTGTGTGGTTTCCAGCTCGCCATGTACT
ACAACGGCTATATCATCCTCTGCATCTTCCTCGGCGCTTTTTTCGGAGCCTTCATCTTCCAGTGGGAGACTCTGC
GTTTCGGGTATGTATACTCCTTCCTTTCTGCAGCCGGAAGGGGGCGTCTCCTCGTCCTCACCAGGGCAACGGCGC
GCTGACGCGTCTCCGCCTTGGCAGGGGTCAGCAGACGAGTGCGGCGGAGGAAGCCACCGTCTGTTGCGGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail