Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|371
Gene name
LocationContig_1070:91..2093
Strand-
Gene length (bp)2002
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08733 PalH PalH/RIM21 7.1E-114 18 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RY98|PALH_NEUCR pH-response regulator protein palH/prr-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-4 PE=3 SV=1 18 519 1.0E-180
sp|Q52E66|PALH_MAGO7 pH-response regulator protein palH/RIM21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM21 PE=3 SV=1 17 513 7.0E-160
sp|Q5V9L7|PALH_BOTFB pH-response regulator protein palH/RIM21 OS=Botryotinia fuckeliana (strain B05.10) GN=palH PE=3 SV=2 12 563 1.0E-142
sp|Q9P904|PALH_EMENI pH-response regulator protein palH/RIM21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palH PE=3 SV=1 8 523 6.0E-133
sp|Q9UVF6|PALH_YARLI pH-response regulator protein palH/RIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM21 PE=3 SV=2 84 387 4.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RY98|PALH_NEUCR pH-response regulator protein palH/prr-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-4 PE=3 SV=1 18 519 1.0E-180
sp|Q52E66|PALH_MAGO7 pH-response regulator protein palH/RIM21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM21 PE=3 SV=1 17 513 7.0E-160
sp|Q5V9L7|PALH_BOTFB pH-response regulator protein palH/RIM21 OS=Botryotinia fuckeliana (strain B05.10) GN=palH PE=3 SV=2 12 563 1.0E-142
sp|Q9P904|PALH_EMENI pH-response regulator protein palH/RIM21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palH PE=3 SV=1 8 523 6.0E-133
sp|Q9UVF6|PALH_YARLI pH-response regulator protein palH/RIM21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM21 PE=3 SV=2 84 387 4.0E-43
sp|Q6BPR6|PALH_DEBHA pH-response regulator protein palH/RIM21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RIM21 PE=3 SV=2 18 392 1.0E-16
sp|Q6CXK7|PALH_KLULA pH-response regulator protein palH/RIM21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM21 PE=3 SV=1 27 384 6.0E-15
sp|P48565|PALH_YEAST pH-response regulator protein palH/RIM21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM21 PE=1 SV=1 144 384 6.0E-12
sp|Q758G4|PALH_ASHGO pH-response regulator protein palH/RIM21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM21 PE=3 SV=1 89 460 6.0E-11
sp|Q59YK4|PALH_CANAL pH-response regulator protein palH/RIM21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM21 PE=3 SV=1 18 429 8.0E-11
sp|Q6FJT9|PALH_CANGA pH-response regulator protein palH/RIM21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RIM21 PE=3 SV=1 173 384 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 91 113 22
2 228 250 22
3 270 292 22
4 305 327 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|371
METLTLASTTITAAPTLCTTTLLPAHGLLTMSNAPSSVVLASAVVYQVPCPTAKPVSALAVISAEDAAGAKADPR
DSSSDTRFSDFRDPFYASTFPICYALAATTVTAYMLLIMLFITPRSFLDGGVVYLGRRRGFTHSAGGESIGGRPW
LQKVAALTVAVSLTIATHDTFKVAQRQYQWGAQNAGVLQIAVMGSMELRVIRLISNTFLWLAQAQTLIRLFPRHR
EKVIIKWAAFALITLDLIFSALNSFKDRDRALYPNAMGGSFDHPVPALSYLFQLLLGVLYAAWVIYYSLMKKRYA
FYHPLMKNMPLLAMISLVSILIPVVFFIMDISKPEFTGWGDYVRWVGAAAASVIVWEWVERIEALEREEKKDGIL
GREVFDGDETLEVNASEFPWLRHRKHRKDDGAGGADRSSGLEGGGGGGGGAHPRDLCALRANGWHGVSAITGRQR
AQARDAHAADEQHTPRIMGDILRPARWPSRPAPAVTPVSRTDTPSAASTVYAVRYQGTSDSNSRTPDPPPPLPHA
ADVLRRNGPSRSSWRRGGDRGGDDDYGPAANQALAAAAAPDEDGALSLPRRSTDLEAAVDAASPEPTSPWRTLSL
GKNAMSEKEEGEAEARMKATPVTRRNYGKSYDRRRTRRVCR*
Coding >Hirsu2|371
ATGGAGACGTTGACGCTCGCCTCGACCACCATCACGGCGGCGCCCACGCTATGCACGACGACGCTCCTGCCCGCC
CACGGGCTCCTGACCATGTCCAACGCCCCGTCGTCGGTCGTTCTCGCCAGCGCCGTCGTCTACCAGGTGCCGTGT
CCGACAGCCAAGCCCGTCAGCGCCCTGGCCGTCATCTCCGCCGAGGACGCCGCCGGGGCCAAGGCGGACCCGCGC
GACTCGTCGTCCGACACCCGCTTCTCCGACTTCCGTGATCCCTTCTACGCGTCCACCTTCCCCATCTGCTACGCC
CTGGCCGCCACCACCGTCACCGCCTACATGCTCCTCATCATGCTCTTCATCACCCCGCGCTCCTTCCTCGACGGC
GGCGTCGTCTACCTCGGCCGCCGCCGCGGCTTCACCCACTCCGCCGGCGGCGAGAGCATCGGCGGCCGGCCCTGG
CTGCAAAAGGTGGCCGCCCTCACCGTCGCCGTCTCCCTTACCATCGCCACCCACGACACCTTCAAGGTCGCCCAG
CGCCAGTACCAATGGGGTGCCCAGAACGCCGGCGTCCTGCAGATTGCCGTCATGGGCAGCATGGAGCTCCGCGTC
ATCCGCCTCATCTCCAACACCTTCCTCTGGCTCGCCCAGGCCCAGACGCTGATCCGCCTCTTCCCCCGCCACCGG
GAAAAGGTCATCATCAAGTGGGCCGCCTTCGCCCTCATCACCCTCGACCTCATCTTCAGCGCCCTCAACAGCTTC
AAGGACCGCGACCGGGCCCTCTACCCCAACGCCATGGGCGGCAGTTTCGACCACCCCGTCCCGGCCCTCAGTTAC
CTCTTCCAGCTGCTCCTCGGCGTCCTCTACGCCGCCTGGGTCATCTACTACTCGCTCATGAAGAAGCGCTACGCC
TTCTACCATCCGCTCATGAAGAACATGCCGCTCCTCGCCATGATCTCCCTCGTCTCCATCCTCATCCCCGTCGTC
TTCTTCATCATGGACATATCCAAGCCCGAGTTCACCGGCTGGGGCGACTACGTGCGCTGGGTCGGCGCCGCCGCC
GCCAGCGTCATCGTCTGGGAGTGGGTCGAGCGCATCGAGGCCCTGGAGCGGGAGGAGAAGAAGGACGGCATCCTC
GGCAGGGAGGTCTTCGACGGCGACGAAACGCTCGAAGTCAACGCCTCCGAGTTCCCCTGGCTCCGCCACCGCAAA
CACCGCAAGGACGACGGCGCCGGTGGTGCCGACCGCTCGAGCGGCCTCGAAGGTGGCGGCGGCGGAGGCGGCGGC
GCCCACCCGCGCGACCTCTGCGCGCTCCGCGCAAACGGCTGGCACGGCGTGTCGGCCATCACGGGCCGCCAACGG
GCACAGGCGCGCGACGCGCACGCGGCCGACGAGCAGCACACGCCACGCATCATGGGCGACATCCTGCGGCCGGCG
CGCTGGCCCTCGCGGCCCGCACCCGCCGTGACGCCCGTCAGCCGAACGGACACGCCCAGCGCGGCCAGCACCGTC
TACGCGGTCCGATACCAGGGCACTTCCGACTCCAATTCCAGGACGCCCGACCCCCCGCCGCCTCTGCCCCACGCC
GCGGACGTTTTGCGACGAAACGGACCGTCTCGAAGCTCCTGGAGAAGAGGAGGCGACCGCGGCGGCGACGACGAT
TACGGACCTGCTGCCAACCAGGCTCTGGCGGCGGCGGCGGCCCCCGACGAAGACGGCGCACTGTCGCTGCCGAGG
AGGTCGACCGACCTGGAAGCGGCAGTCGACGCGGCGTCGCCGGAGCCGACGAGTCCATGGCGGACGCTGAGTCTG
GGCAAGAACGCCATGTCGGAGAAGGAGGAAGGGGAGGCAGAGGCGCGCATGAAGGCGACGCCGGTGACGCGGAGA
AACTACGGGAAAAGCTACGACCGACGGCGGACACGGAGAGTCTGCCGGTGA
Transcript >Hirsu2|371
ATGGAGACGTTGACGCTCGCCTCGACCACCATCACGGCGGCGCCCACGCTATGCACGACGACGCTCCTGCCCGCC
CACGGGCTCCTGACCATGTCCAACGCCCCGTCGTCGGTCGTTCTCGCCAGCGCCGTCGTCTACCAGGTGCCGTGT
CCGACAGCCAAGCCCGTCAGCGCCCTGGCCGTCATCTCCGCCGAGGACGCCGCCGGGGCCAAGGCGGACCCGCGC
GACTCGTCGTCCGACACCCGCTTCTCCGACTTCCGTGATCCCTTCTACGCGTCCACCTTCCCCATCTGCTACGCC
CTGGCCGCCACCACCGTCACCGCCTACATGCTCCTCATCATGCTCTTCATCACCCCGCGCTCCTTCCTCGACGGC
GGCGTCGTCTACCTCGGCCGCCGCCGCGGCTTCACCCACTCCGCCGGCGGCGAGAGCATCGGCGGCCGGCCCTGG
CTGCAAAAGGTGGCCGCCCTCACCGTCGCCGTCTCCCTTACCATCGCCACCCACGACACCTTCAAGGTCGCCCAG
CGCCAGTACCAATGGGGTGCCCAGAACGCCGGCGTCCTGCAGATTGCCGTCATGGGCAGCATGGAGCTCCGCGTC
ATCCGCCTCATCTCCAACACCTTCCTCTGGCTCGCCCAGGCCCAGACGCTGATCCGCCTCTTCCCCCGCCACCGG
GAAAAGGTCATCATCAAGTGGGCCGCCTTCGCCCTCATCACCCTCGACCTCATCTTCAGCGCCCTCAACAGCTTC
AAGGACCGCGACCGGGCCCTCTACCCCAACGCCATGGGCGGCAGTTTCGACCACCCCGTCCCGGCCCTCAGTTAC
CTCTTCCAGCTGCTCCTCGGCGTCCTCTACGCCGCCTGGGTCATCTACTACTCGCTCATGAAGAAGCGCTACGCC
TTCTACCATCCGCTCATGAAGAACATGCCGCTCCTCGCCATGATCTCCCTCGTCTCCATCCTCATCCCCGTCGTC
TTCTTCATCATGGACATATCCAAGCCCGAGTTCACCGGCTGGGGCGACTACGTGCGCTGGGTCGGCGCCGCCGCC
GCCAGCGTCATCGTCTGGGAGTGGGTCGAGCGCATCGAGGCCCTGGAGCGGGAGGAGAAGAAGGACGGCATCCTC
GGCAGGGAGGTCTTCGACGGCGACGAAACGCTCGAAGTCAACGCCTCCGAGTTCCCCTGGCTCCGCCACCGCAAA
CACCGCAAGGACGACGGCGCCGGTGGTGCCGACCGCTCGAGCGGCCTCGAAGGTGGCGGCGGCGGAGGCGGCGGC
GCCCACCCGCGCGACCTCTGCGCGCTCCGCGCAAACGGCTGGCACGGCGTGTCGGCCATCACGGGCCGCCAACGG
GCACAGGCGCGCGACGCGCACGCGGCCGACGAGCAGCACACGCCACGCATCATGGGCGACATCCTGCGGCCGGCG
CGCTGGCCCTCGCGGCCCGCACCCGCCGTGACGCCCGTCAGCCGAACGGACACGCCCAGCGCGGCCAGCACCGTC
TACGCGGTCCGATACCAGGGCACTTCCGACTCCAATTCCAGGACGCCCGACCCCCCGCCGCCTCTGCCCCACGCC
GCGGACGTTTTGCGACGAAACGGACCGTCTCGAAGCTCCTGGAGAAGAGGAGGCGACCGCGGCGGCGACGACGAT
TACGGACCTGCTGCCAACCAGGCTCTGGCGGCGGCGGCGGCCCCCGACGAAGACGGCGCACTGTCGCTGCCGAGG
AGGTCGACCGACCTGGAAGCGGCAGTCGACGCGGCGTCGCCGGAGCCGACGAGTCCATGGCGGACGCTGAGTCTG
GGCAAGAACGCCATGTCGGAGAAGGAGGAAGGGGAGGCAGAGGCGCGCATGAAGGCGACGCCGGTGACGCGGAGA
AACTACGGGAAAAGCTACGACCGACGGCGGACACGGAGAGTCTGCCGGTGA
Gene >Hirsu2|371
ATGGAGACGTTGACGCTCGCCTCGACCACCATCACGGCGGCGCCCACGCTATGCACGACGACGCTCCTGCCCGCC
CACGGGCTCCTGACCATGTCCAACGCCCCGTCGTCGGTCGTTCTCGCCAGCGCCGTCGTCTACCAGGTGCCGTGT
CCGACAGCCAAGCCCGTCAGCGCCCTGGCCGTCATCTCCGCCGAGGACGCCGCCGGGGCCAAGGCGGACCCGCGC
GACTCGTCGTCCGACACCCGCTTCTCCGACTTCCGTGATCCCTTCTACGCGTCCACCTTCCCCATCTGCTACGCC
CTGGCCGCCACCACCGTCACCGCCTACATGCTCCTCATCATGCTCTTCATCACCCCGCGCTCCTTCCTCGACGGC
GGCGTCGTCTACCTCGGCCGCCGCCGCGGCTTCACCCACTCCGCCGGCGGCGAGAGCATCGGCGGCCGGCCCTGG
CTGCAAAAGGTGGCCGCCCTCACCGTCGCCGTCTCCCTTACCATCGCCACCCACGACACCTTCAAGGTCGCCCAG
CGCCAGTACCAATGGGGTGCCCAGAACGCCGGCGTCCTGCAGATTGCCGTCATGGGCAGCATGGAGCTCCGCGTC
ATCCGCCTCATCTCCAACACCTTCCTCTGGCTCGCCCAGGCCCAGACGCTGATCCGCCTCTTCCCCCGCCACCGG
GAAAAGGTCATCATCAAGTGGGCCGCCTTCGCCCTCATCACCCTCGACCTCATCTTCAGCGCCCTCAACAGCTTC
AAGGACCGCGACCGGGCCCTCTACCCCAACGCCATGGGCGGCAGTTTCGACCACCCCGTCCCGGCCCTCAGTTAC
CTCTTCCAGCTGCTCCTCGGCGTCCTCTACGCCGCCTGGGTCATCTACTACTCGCTCATGAAGAAGCGCTACGCC
TTCTACCATCCGCTCATGAAGAACATGCCGCTCCTCGCCATGATCTCCCTCGTCTCCATCCTCATCCCCGTCGTC
TTCTTCATCATGGACATATCCAAGCCCGAGTTCACCGGCTGGGGCGACTACGTGCGCTGGGTCGGCGCCGCCGCC
GCCAGCGTCATCGTCTGGGAGTGGGTCGAGCGCATCGAGGCCCTGGAGCGGGAGGAGAAGAAGGACGGCATCCTC
GGCAGGGAGGTCTTCGACGGCGACGAAACGCTCGAAGTCAACGCCTCCGAGTTCCCCTGGCTCCGCCACCGCAAA
CACCGCAAGGACGACGGCGCCGGTGGTGCCGACCGCTCGAGCGGCCTCGAAGGTGGCGGCGGCGGAGGCGGCGGC
GCCCACCCGCGCGACCTCTGCGCGCTCCGCGCAAACGGCTGGCACGGCGTGTCGGCCATCACGGGCCGCCAACGG
GCACAGGCGCGCGACGCGCACGCGGCCGACGAGCAGCACACGCCACGCATCATGGGCGACATCCTGCGGCCGGCG
CGCTGGCCCTCGCGGCCCGCACCCGCCGTGACGCCCGTCAGCCGAACGGACACGCCCAGCGCGGCCAGCACCGTC
TACGCGGTCCGATACCAGGGCACTTCCGACTCCAATTCCAGGACGCCCGACCCCCCGCCGCCTCTGCCCCACGCC
GCGGACGTTTTGCGACGAAACGGACCGTCTCGAAGCTCCTGGAGAAGAGGAGGCGACCGCGGCGGCGACGACGAT
TACGGACCTGCTGCCAACCAGGCTCTGGCGGCGGCGGCGGCCCCCGACGAAGACGGCGCACTGTCGCTGCCGAGG
AGGTCGACCGACCTGGAAGCGGCAGTCGACGCGGCGTCGCCGGAGCCGACGAGTCCATGGCGGACGCTGAGTCTG
GGCAAGAACGCCATGTCGGAGAAGGAGGAAGGGGAGGCAGAGGCGCGCATGAAGGCGACGCCGGTGACGTCGGAG
CCGCGGACTCGGGACGAGGCTGGCCGATGGGACATACGTTCAAGACTGGAGCTGTTCGCCGCGAATCAGGCGGAG
AAACTACGGGAAAAGCTACGACCGACGGCGGACACGGAGAGTCTGCCGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail