Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3703
Gene name
LocationContig_2:15082..16056
Strand+
Gene length (bp)974
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein 1.5E-07 104 236

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular|Endoplasmic reticulum Signal peptide 0.299 0.1385 0.6786 0.1924 0.209 0.0242 0.6429 0.1875 0.1461 0.2013

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5163
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1005
Ophiocordyceps australis map64 (Brazil) OphauB2|6438
Ophiocordyceps camponoti-rufipedis Ophun1|2680
Ophiocordyceps subramaniannii Hirsu2|3703 (this protein)
Ophiocordyceps subramaniannii Hirsu2|8019

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3703
MDDIKRDFEGKFPGMSLNLTIDLSKYLDVRLDEQLASDNVYVDSIILQTVHNFPRWAQDNALLNYAPLGVDQVYP
AFKDSESSSWYGLEILYWKNIWSTEKLPGADFDTFQEFLKPGYKNRLVLAYPNDEDAVLFAFDLIMQRHGRAWFD
ALLKQNPRWIRGVTRTSTIIRECNSSAAASFTSTAGFRPSPGLGSAFPKDDLFVSWAQTGAILKKAPHPEGAKLL
HAYLLSREVQESMGWSVRADVPPPAGLPDIMHMPTTNPTAFARWMSDRQTVERLRLWFESKLGTPQGESPLVSGK
GYD*
Coding >Hirsu2|3703
ATGGACGATATAAAGCGAGACTTCGAGGGAAAATTCCCCGGCATGAGTCTCAACCTCACGATCGACCTCTCCAAG
TATCTCGATGTTCGGCTCGACGAGCAACTGGCTTCGGATAACGTCTACGTCGACAGCATCATCCTGCAGACCGTC
CACAACTTCCCGCGCTGGGCACAGGACAATGCCCTGCTGAACTACGCGCCGCTCGGCGTGGACCAAGTCTATCCG
GCGTTCAAAGACAGCGAGTCTTCGTCCTGGTACGGGCTCGAAATTCTATACTGGAAGAACATTTGGAGCACCGAA
AAGCTCCCCGGGGCCGACTTCGATACGTTCCAGGAGTTCCTCAAGCCCGGGTATAAGAACCGGTTGGTGTTGGCG
TACCCCAACGACGAGGATGCCGTCCTGTTCGCCTTCGACCTTATAATGCAGCGGCACGGACGGGCCTGGTTCGAC
GCTCTGCTGAAGCAAAACCCGCGCTGGATCCGCGGCGTCACGAGGACGAGCACAATCATCCGAGAATGCAACAGC
AGCGCGGCCGCGAGCTTCACGAGCACCGCGGGCTTCCGGCCCAGCCCGGGGCTCGGCTCGGCCTTCCCCAAAGAC
GACCTGTTCGTCAGCTGGGCGCAGACGGGCGCCATACTGAAGAAGGCGCCGCACCCGGAGGGCGCCAAGCTGCTC
CACGCCTATCTGCTGAGCCGCGAGGTCCAGGAGTCGATGGGGTGGAGCGTCCGAGCGGATGTCCCTCCGCCTGCG
GGCCTTCCCGACATTATGCACATGCCGACGACGAACCCGACGGCGTTTGCTCGCTGGATGTCGGATCGACAGACG
GTCGAGAGGCTGAGGCTTTGGTTCGAGAGCAAGCTGGGCACTCCGCAGGGCGAGAGTCCGTTGGTTAGCGGGAAG
GGTTACGATTGA
Transcript >Hirsu2|3703
ATGGACGATATAAAGCGAGACTTCGAGGGAAAATTCCCCGGCATGAGTCTCAACCTCACGATCGACCTCTCCAAG
TATCTCGATGTTCGGCTCGACGAGCAACTGGCTTCGGATAACGTCTACGTCGACAGCATCATCCTGCAGACCGTC
CACAACTTCCCGCGCTGGGCACAGGACAATGCCCTGCTGAACTACGCGCCGCTCGGCGTGGACCAAGTCTATCCG
GCGTTCAAAGACAGCGAGTCTTCGTCCTGGTACGGGCTCGAAATTCTATACTGGAAGAACATTTGGAGCACCGAA
AAGCTCCCCGGGGCCGACTTCGATACGTTCCAGGAGTTCCTCAAGCCCGGGTATAAGAACCGGTTGGTGTTGGCG
TACCCCAACGACGAGGATGCCGTCCTGTTCGCCTTCGACCTTATAATGCAGCGGCACGGACGGGCCTGGTTCGAC
GCTCTGCTGAAGCAAAACCCGCGCTGGATCCGCGGCGTCACGAGGACGAGCACAATCATCCGAGAATGCAACAGC
AGCGCGGCCGCGAGCTTCACGAGCACCGCGGGCTTCCGGCCCAGCCCGGGGCTCGGCTCGGCCTTCCCCAAAGAC
GACCTGTTCGTCAGCTGGGCGCAGACGGGCGCCATACTGAAGAAGGCGCCGCACCCGGAGGGCGCCAAGCTGCTC
CACGCCTATCTGCTGAGCCGCGAGGTCCAGGAGTCGATGGGGTGGAGCGTCCGAGCGGATGTCCCTCCGCCTGCG
GGCCTTCCCGACATTATGCACATGCCGACGACGAACCCGACGGCGTTTGCTCGCTGGATGTCGGATCGACAGACG
GTCGAGAGGCTGAGGCTTTGGTTCGAGAGCAAGCTGGGCACTCCGCAGGGCGAGAGTCCGTTGGTTAGCGGGAAG
GGTTACGATTGA
Gene >Hirsu2|3703
ATGGACGATATAAAGCGAGACTTCGAGGGAAAATTCCCCGGCATGAGTCTCAACCTCACGATCGACCTCTCCAAG
TATCTCGATGTTCGGCTCGACGAGCAACTGGCTTCGGATAACGTCTACGTCGACAGCATCATCCTGCAGACCGTC
CACAACTTCCCGCGCTGGGCACAGGACAATGCCCTGCTGAACTACGCGCCGCTCGGCGTGGACCAAGTCTATCCG
GCGTTCAAAGACAGCGAGTCTTCGTCCTGGTACGGGCTCGAAATTCTATACTGGAAGAACATTTGGAGCACCGAA
AAGCTCCCCGGGGCCGACTTCGATACGTTCCAGGAGTTCCTCAAGCCCGGGTATAAGAACCGGTTGGTGTTGGCG
TACCCCAACGACGAGGATGCCGTCCTGTTCGCCTTCGACCTTATGTGAGCTCTGGACTCGGCAATCGATTGCGCC
GACGGACTTTCGAACTAATTCGTCTCCCCAGAATGCAGCGGCACGGACGGGCCTGGTTCGACGCTCTGCTGAAGC
AAAACCCGCGCTGGATCCGCGGCGTCACGAGGACGAGCACAATCATCCGAGAATGCAACAGCAGCGCGGCCGCGA
GCTTCACGAGCACCGCGGGCTTCCGGCCCAGCCCGGGGCTCGGCTCGGCCTTCCCCAAAGACGACCTGTTCGTCA
GCTGGGCGCAGACGGGCGCCATACTGAAGAAGGCGCCGCACCCGGAGGGCGCCAAGCTGCTCCACGCCTATCTGC
TGAGCCGCGAGGTCCAGGAGTCGATGGGGTGGAGCGTCCGAGCGGATGTCCCTCCGCCTGCGGGCCTTCCCGACA
TTATGCACATGCCGACGACGAACCCGACGGCGTTTGCTCGCTGGATGTCGGATCGACAGACGGTCGAGAGGCTGA
GGCTTTGGTTCGAGAGCAAGCTGGGCACTCCGCAGGGCGAGAGTCCGTTGGTTAGCGGGAAGGGTTACGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail