Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3698
Gene name
LocationContig_2:29..2838
Strand-
Gene length (bp)2809
Transcript length (bp)2412
Coding sequence length (bp)2412
Protein length (aa) 804

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 3.0E-61 59 447

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7I1|KHA1_SCHPO K(+)/H(+) antiporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kha1 PE=3 SV=2 33 744 8.0E-141
sp|P40309|KHA1_YEAST K(+)/H(+) antiporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KHA1 PE=1 SV=1 28 623 2.0E-135
sp|Q9SUQ7|CHX17_ARATH Cation/H(+) antiporter 17 OS=Arabidopsis thaliana GN=CHX17 PE=1 SV=1 32 746 2.0E-107
sp|Q9FFR9|CHX18_ARATH Cation/H(+) antiporter 18 OS=Arabidopsis thaliana GN=CHX18 PE=2 SV=1 10 746 4.0E-100
sp|Q1HDT3|CHX16_ARATH Cation/H(+) antiporter 16 OS=Arabidopsis thaliana GN=CHX16 PE=2 SV=1 7 753 5.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7I1|KHA1_SCHPO K(+)/H(+) antiporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kha1 PE=3 SV=2 33 744 8.0E-141
sp|P40309|KHA1_YEAST K(+)/H(+) antiporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KHA1 PE=1 SV=1 28 623 2.0E-135
sp|Q9SUQ7|CHX17_ARATH Cation/H(+) antiporter 17 OS=Arabidopsis thaliana GN=CHX17 PE=1 SV=1 32 746 2.0E-107
sp|Q9FFR9|CHX18_ARATH Cation/H(+) antiporter 18 OS=Arabidopsis thaliana GN=CHX18 PE=2 SV=1 10 746 4.0E-100
sp|Q1HDT3|CHX16_ARATH Cation/H(+) antiporter 16 OS=Arabidopsis thaliana GN=CHX16 PE=2 SV=1 7 753 5.0E-96
sp|Q9LUN4|CHX19_ARATH Cation/H(+) antiporter 19 OS=Arabidopsis thaliana GN=CHX19 PE=2 SV=1 14 752 8.0E-94
sp|Q9SIT5|CHX15_ARATH Cation/H(+) antiporter 15 OS=Arabidopsis thaliana GN=CHX15 PE=2 SV=1 70 746 2.0E-90
sp|Q9M353|CHX20_ARATH Cation/H(+) antiporter 20 OS=Arabidopsis thaliana GN=CHX20 PE=2 SV=1 29 746 2.0E-85
sp|P72973|NHAS4_SYNY3 Na(+)/H(+) antiporter NhaS4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nhaS4 PE=3 SV=1 46 452 3.0E-61
sp|Q8VYD4|CHX23_ARATH Cation/H(+) antiporter 23, chloroplastic OS=Arabidopsis thaliana GN=CHX23 PE=1 SV=1 51 751 4.0E-40
sp|Q1HDT2|CHX24_ARATH Cation/H(+) antiporter 24 OS=Arabidopsis thaliana GN=CHX24 PE=2 SV=2 33 746 7.0E-40
sp|Q9LMJ1|CHX14_ARATH Cation/H(+) antiporter 14 OS=Arabidopsis thaliana GN=CHX14 PE=2 SV=1 24 746 1.0E-38
sp|Q9FGH6|CHX25_ARATH Cation/H(+) antiporter 25 OS=Arabidopsis thaliana GN=CHX25 PE=2 SV=1 33 481 4.0E-37
sp|Q9SKA9|CHX21_ARATH Cation/H(+) antiporter 21 OS=Arabidopsis thaliana GN=CHX21 PE=2 SV=2 18 466 2.0E-34
sp|B3VQ24|GERT_BACCE Probable Na(+)/H(+) antiporter GerT OS=Bacillus cereus GN=gerT PE=3 SV=1 58 451 3.0E-31
sp|Q9KI10|GERN_BACCE Na(+)/H(+)-K(+) antiporter GerN OS=Bacillus cereus GN=gerN PE=1 SV=1 52 448 2.0E-30
sp|O22920|CHX13_ARATH Cation/H(+) symporter 13 OS=Arabidopsis thaliana GN=CHX13 PE=1 SV=1 33 458 7.0E-30
sp|Q9FYC1|CHX4_ARATH Cation/H(+) antiporter 4 OS=Arabidopsis thaliana GN=CHX4 PE=2 SV=1 58 775 8.0E-26
sp|Q3EDG3|CHX5_ARATH Cation/H(+) antiporter 5 OS=Arabidopsis thaliana GN=CHX5 PE=2 SV=1 100 451 2.0E-23
sp|Q9M007|CHX27_ARATH Cation/H(+) antiporter 27 OS=Arabidopsis thaliana GN=CHX27 PE=2 SV=2 33 622 7.0E-21
sp|Q9FFB8|CHX3_ARATH Cation/H(+) antiporter 3 OS=Arabidopsis thaliana GN=CHX3 PE=2 SV=1 58 788 1.0E-19
sp|Q9FFB7|CHX9_ARATH Cation/H(+) antiporter 9 OS=Arabidopsis thaliana GN=CHX9 PE=2 SV=1 58 476 3.0E-19
sp|Q8GX92|CHX6A_ARATH Cation/H(+) antiporter 6A OS=Arabidopsis thaliana GN=CHX6a PE=2 SV=2 73 453 4.0E-19
sp|Q58P71|CHX8_ARATH Cation/H(+) antiporter 8 OS=Arabidopsis thaliana GN=CHX8 PE=2 SV=1 76 456 7.0E-17
sp|Q58P69|CHX10_ARATH Cation/H(+) antiporter 10 OS=Arabidopsis thaliana GN=CHX10 PE=2 SV=2 54 747 1.0E-16
sp|P26235|NAPA_ENTHR Na(+)/H(+) antiporter OS=Enterococcus hirae GN=napA PE=1 SV=1 76 461 1.0E-15
sp|Q9SAK8|CHX2_ARATH Cation/H(+) antiporter 2 OS=Arabidopsis thaliana GN=CHX2 PE=2 SV=1 47 440 5.0E-15
sp|Q55190|NHAS3_SYNY3 High-affinity Na(+)/H(+) antiporter NhaS3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nhaS3 PE=1 SV=1 48 466 1.0E-14
sp|Q8L709|CHX28_ARATH Cation/H(+) antiporter 28 OS=Arabidopsis thaliana GN=CHX28 PE=2 SV=2 49 746 2.0E-14
sp|Q9M008|CHX26_ARATH Cation/H(+) antiporter 26 OS=Arabidopsis thaliana GN=CHX26 PE=2 SV=2 32 632 6.0E-13
sp|Q9ZUV9|CHX7_ARATH Cation/H(+) antiporter 7 OS=Arabidopsis thaliana GN=CHX7 PE=2 SV=2 68 758 8.0E-12
sp|Q9FYC0|CHX12_ARATH Cation/H(+) antiporter 12 OS=Arabidopsis thaliana GN=CHX12 PE=2 SV=2 82 467 1.0E-11
sp|Q9FYB9|CHX11_ARATH Cation/H(+) antiporter 11 OS=Arabidopsis thaliana GN=CHX11 PE=2 SV=2 51 747 9.0E-11
sp|P0CG16|CHX6B_ARATH Cation/H(+) antiporter 6B OS=Arabidopsis thaliana GN=CHX6b PE=2 SV=1 113 451 2.0E-10
sp|Q9SA37|CHX1_ARATH Cation/H(+) antiporter 1 OS=Arabidopsis thaliana GN=CHX1 PE=2 SV=1 47 450 7.0E-09
sp|Q58671|NAH3_METJA Probable Na(+)/H(+) antiporter 3 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1275 PE=3 SV=1 70 447 2.0E-08
sp|Q2W031|MAGA_MAGSA Iron transporter MagA OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=magA PE=1 SV=1 70 439 3.0E-07
sp|O31615|YJBQ_BACSU Putative Na(+)/H(+) antiporter YjbQ OS=Bacillus subtilis (strain 168) GN=yjbQ PE=3 SV=1 57 356 4.0E-07
sp|A8AQP0|KEFB_CITK8 Glutathione-regulated potassium-efflux system protein KefB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=kefB PE=3 SV=1 78 502 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006812 cation transport Yes
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0022804 active transmembrane transporter activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0006811 ion transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0015297 antiporter activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 49 71 22
2 78 100 22
3 115 137 22
4 144 166 22
5 181 203 22
6 215 237 22
7 247 269 22
8 290 312 22
9 336 358 22
10 365 387 22
11 397 419 22
12 432 454 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3698
MSSLATLATALTATASSAAPSSTSANRATPQGGVIEGANPIKYDPSNPIILFIVQTSLIVIVCHALHWPLAKIRQ
PRVIAEVVGGIILGPSVMGRVPGFRDAIFPKESLPNLNLVANLGLVLYLFLIGLETDVRFLLRNWRVATSVAFAG
LALPFAIGCALAWGVYNAFRQDDGVQPISFSTYMLFIGIAIAITAFPVLCRILTELKLLDTPVGVITLSAGVAND
VVGWVLLALCVALVNAGNGLSALWILLSCVGFMLFLLYLVRPALFWLLRRTGSIEHDPSQSVISLILLLALASAF
FTGIIGVHPIFGGFMAGLILPRENRFNIRVTEKLEDLIGAIFLPLYFTLSGLNTNLGLLNSGITWGYVFATTFVA
FFTKIIGASLAARLNGLVWRESFTIGVLMSCKGLVELIVLNIGLQANILSTRTFTIFVVMALLTTFTTTPIVSAL
YPPWYQAKIAAWKRGEIDWETGAPISSMDGDDDDSQNKSDAVRRVGKVLAYLRLDSMPALLNLLSLFGGPEAASS
RSVGGKDVSEVSDGRGAGPVWVHGMRLLQLTDRDSSVMTVSQVAEYSRHDPIVNTFRTVGRLHNLAVSGEVAIMP
EARFAEALVGKAAAVSSDMILLPWSETGGMGDSPILSSATLDDRMASGYGTFVKAVLDAHDRSIGVFFSRTDEVG
PDGSPASSDRLTLSRQTSFGISAADDRPVASRPARPYHVFVAYFGGDDDVLALRLALQLCENAQAAATVVRVSAP
GGADASADVFDMIRSHVPADVAARVDFSVAPASTTIQDLVRLALPGPDRKRVV*
Coding >Hirsu2|3698
ATGTCTTCCCTCGCCACCCTCGCCACAGCCCTCACGGCGACGGCTTCGTCCGCCGCCCCGTCCTCCACCAGCGCG
AATCGAGCAACGCCCCAGGGCGGCGTTATCGAGGGCGCCAACCCGATAAAGTACGACCCCAGCAATCCCATCATC
CTCTTCATCGTTCAGACGAGCCTGATCGTCATTGTCTGCCATGCCCTGCACTGGCCGCTCGCAAAGATCCGCCAG
CCTCGCGTCATCGCCGAGGTCGTGGGCGGCATCATCCTCGGCCCCTCCGTCATGGGCCGTGTCCCGGGCTTCCGC
GACGCCATCTTCCCCAAGGAATCCCTGCCCAACCTCAATCTTGTCGCCAACCTCGGCCTTGTCCTCTATCTCTTC
CTCATCGGCCTCGAGACCGATGTCCGCTTCCTCCTCCGCAATTGGCGCGTTGCCACCTCCGTCGCCTTCGCCGGC
CTCGCCCTCCCCTTCGCCATCGGCTGTGCCCTGGCCTGGGGCGTCTACAACGCCTTTCGCCAAGACGATGGCGTC
CAGCCCATCAGCTTCAGCACCTACATGCTCTTCATTGGCATCGCCATCGCCATCACCGCCTTTCCCGTGCTTTGC
CGTATCTTGACCGAGCTCAAGCTTCTCGACACCCCGGTCGGAGTCATTACCCTGTCAGCCGGTGTCGCCAACGAT
GTTGTCGGCTGGGTCTTACTTGCGCTTTGCGTCGCGCTCGTCAACGCCGGCAACGGCCTCTCCGCCCTCTGGATC
CTGCTCTCTTGTGTTGGGTTCATGCTCTTCCTGCTGTACCTTGTCCGGCCCGCCCTTTTCTGGCTCCTTCGCCGC
ACCGGAAGCATCGAGCATGACCCCTCGCAGAGCGTCATCTCCCTCATTCTCCTCCTCGCCCTGGCTTCGGCCTTC
TTCACCGGCATCATCGGCGTCCACCCCATCTTCGGCGGCTTCATGGCTGGCCTCATCCTCCCTCGCGAAAACAGG
TTCAACATTCGCGTTACCGAGAAGCTCGAGGATCTCATAGGCGCCATCTTCCTGCCCCTATACTTCACCCTGTCC
GGTCTCAACACCAACCTCGGCCTGCTGAATTCGGGCATCACGTGGGGGTACGTCTTTGCCACCACCTTTGTGGCC
TTCTTCACCAAAATCATCGGCGCTTCCCTTGCCGCTCGACTCAACGGCTTGGTGTGGCGGGAATCCTTCACCATC
GGCGTGCTCATGAGCTGCAAGGGCCTTGTGGAGCTGATTGTGCTTAACATCGGCCTTCAGGCCAACATTCTCAGC
ACGAGAACCTTCACCATCTTCGTCGTCATGGCCCTCCTCACCACCTTCACCACGACGCCCATCGTATCCGCCCTC
TACCCACCCTGGTATCAGGCCAAGATCGCGGCCTGGAAGCGCGGGGAGATCGACTGGGAAACGGGCGCGCCCATC
TCGTCCATGGACGGCGACGACGACGACAGTCAGAACAAGTCGGACGCCGTGAGGCGAGTGGGCAAGGTGCTCGCG
TACCTCCGACTCGACAGCATGCCGGCCCTGCTCAACCTGCTGTCCCTGTTCGGGGGCCCCGAGGCGGCCTCGTCC
CGATCCGTCGGAGGCAAGGACGTCTCGGAGGTCAGCGACGGCCGCGGCGCGGGGCCTGTCTGGGTGCACGGCATG
CGCCTGCTCCAGCTCACGGACCGCGACTCGTCCGTCATGACCGTGTCCCAGGTCGCCGAGTACAGCCGCCACGAC
CCCATCGTCAACACGTTCCGCACCGTCGGCCGGCTCCACAACCTGGCCGTCTCGGGCGAGGTGGCCATCATGCCC
GAGGCGCGCTTCGCCGAGGCCCTCGTTGGCAAGGCGGCCGCCGTCTCGTCGGATATGATCCTCCTCCCCTGGAGC
GAGACGGGCGGCATGGGTGACTCGCCCATCCTGTCGTCGGCCACGCTTGACGACAGGATGGCCTCGGGCTACGGC
ACCTTCGTCAAGGCCGTCCTCGACGCGCACGACCGCAGCATCGGCGTCTTCTTCTCCCGCACCGACGAGGTCGGG
CCCGACGGCTCGCCCGCGTCCTCGGACCGCCTCACCCTTTCGCGCCAGACGTCGTTCGGCATCTCGGCCGCCGAC
GACCGCCCCGTCGCCTCCCGCCCCGCCAGGCCCTACCACGTCTTCGTGGCCTACTTCGGCGGCGACGACGACGTG
CTGGCGCTTCGCCTAGCCCTCCAGCTGTGCGAGAACGCACAGGCCGCCGCCACGGTCGTGCGCGTCTCCGCCCCG
GGGGGCGCCGACGCCTCCGCCGACGTCTTCGACATGATCCGCTCCCACGTCCCGGCCGACGTGGCCGCCCGCGTC
GACTTCAGCGTGGCCCCCGCCTCGACGACCATCCAGGACCTGGTGCGCCTGGCCCTTCCGGGGCCAGATCGGAAG
CGCGTCGTGTAG
Transcript >Hirsu2|3698
ATGTCTTCCCTCGCCACCCTCGCCACAGCCCTCACGGCGACGGCTTCGTCCGCCGCCCCGTCCTCCACCAGCGCG
AATCGAGCAACGCCCCAGGGCGGCGTTATCGAGGGCGCCAACCCGATAAAGTACGACCCCAGCAATCCCATCATC
CTCTTCATCGTTCAGACGAGCCTGATCGTCATTGTCTGCCATGCCCTGCACTGGCCGCTCGCAAAGATCCGCCAG
CCTCGCGTCATCGCCGAGGTCGTGGGCGGCATCATCCTCGGCCCCTCCGTCATGGGCCGTGTCCCGGGCTTCCGC
GACGCCATCTTCCCCAAGGAATCCCTGCCCAACCTCAATCTTGTCGCCAACCTCGGCCTTGTCCTCTATCTCTTC
CTCATCGGCCTCGAGACCGATGTCCGCTTCCTCCTCCGCAATTGGCGCGTTGCCACCTCCGTCGCCTTCGCCGGC
CTCGCCCTCCCCTTCGCCATCGGCTGTGCCCTGGCCTGGGGCGTCTACAACGCCTTTCGCCAAGACGATGGCGTC
CAGCCCATCAGCTTCAGCACCTACATGCTCTTCATTGGCATCGCCATCGCCATCACCGCCTTTCCCGTGCTTTGC
CGTATCTTGACCGAGCTCAAGCTTCTCGACACCCCGGTCGGAGTCATTACCCTGTCAGCCGGTGTCGCCAACGAT
GTTGTCGGCTGGGTCTTACTTGCGCTTTGCGTCGCGCTCGTCAACGCCGGCAACGGCCTCTCCGCCCTCTGGATC
CTGCTCTCTTGTGTTGGGTTCATGCTCTTCCTGCTGTACCTTGTCCGGCCCGCCCTTTTCTGGCTCCTTCGCCGC
ACCGGAAGCATCGAGCATGACCCCTCGCAGAGCGTCATCTCCCTCATTCTCCTCCTCGCCCTGGCTTCGGCCTTC
TTCACCGGCATCATCGGCGTCCACCCCATCTTCGGCGGCTTCATGGCTGGCCTCATCCTCCCTCGCGAAAACAGG
TTCAACATTCGCGTTACCGAGAAGCTCGAGGATCTCATAGGCGCCATCTTCCTGCCCCTATACTTCACCCTGTCC
GGTCTCAACACCAACCTCGGCCTGCTGAATTCGGGCATCACGTGGGGGTACGTCTTTGCCACCACCTTTGTGGCC
TTCTTCACCAAAATCATCGGCGCTTCCCTTGCCGCTCGACTCAACGGCTTGGTGTGGCGGGAATCCTTCACCATC
GGCGTGCTCATGAGCTGCAAGGGCCTTGTGGAGCTGATTGTGCTTAACATCGGCCTTCAGGCCAACATTCTCAGC
ACGAGAACCTTCACCATCTTCGTCGTCATGGCCCTCCTCACCACCTTCACCACGACGCCCATCGTATCCGCCCTC
TACCCACCCTGGTATCAGGCCAAGATCGCGGCCTGGAAGCGCGGGGAGATCGACTGGGAAACGGGCGCGCCCATC
TCGTCCATGGACGGCGACGACGACGACAGTCAGAACAAGTCGGACGCCGTGAGGCGAGTGGGCAAGGTGCTCGCG
TACCTCCGACTCGACAGCATGCCGGCCCTGCTCAACCTGCTGTCCCTGTTCGGGGGCCCCGAGGCGGCCTCGTCC
CGATCCGTCGGAGGCAAGGACGTCTCGGAGGTCAGCGACGGCCGCGGCGCGGGGCCTGTCTGGGTGCACGGCATG
CGCCTGCTCCAGCTCACGGACCGCGACTCGTCCGTCATGACCGTGTCCCAGGTCGCCGAGTACAGCCGCCACGAC
CCCATCGTCAACACGTTCCGCACCGTCGGCCGGCTCCACAACCTGGCCGTCTCGGGCGAGGTGGCCATCATGCCC
GAGGCGCGCTTCGCCGAGGCCCTCGTTGGCAAGGCGGCCGCCGTCTCGTCGGATATGATCCTCCTCCCCTGGAGC
GAGACGGGCGGCATGGGTGACTCGCCCATCCTGTCGTCGGCCACGCTTGACGACAGGATGGCCTCGGGCTACGGC
ACCTTCGTCAAGGCCGTCCTCGACGCGCACGACCGCAGCATCGGCGTCTTCTTCTCCCGCACCGACGAGGTCGGG
CCCGACGGCTCGCCCGCGTCCTCGGACCGCCTCACCCTTTCGCGCCAGACGTCGTTCGGCATCTCGGCCGCCGAC
GACCGCCCCGTCGCCTCCCGCCCCGCCAGGCCCTACCACGTCTTCGTGGCCTACTTCGGCGGCGACGACGACGTG
CTGGCGCTTCGCCTAGCCCTCCAGCTGTGCGAGAACGCACAGGCCGCCGCCACGGTCGTGCGCGTCTCCGCCCCG
GGGGGCGCCGACGCCTCCGCCGACGTCTTCGACATGATCCGCTCCCACGTCCCGGCCGACGTGGCCGCCCGCGTC
GACTTCAGCGTGGCCCCCGCCTCGACGACCATCCAGGACCTGGTGCGCCTGGCCCTTCCGGGGCCAGATCGGAAG
CGCGTCGTGTAG
Gene >Hirsu2|3698
ATGTCTTCCCTCGCCACCCTCGCCACAGCCCTCACGGCGACGGCTTCGTCCGCCGCCCCGTCCTCCACCAGCGCG
AATCGAGCAACGCCCCAGGGCGGCGTTATCGAGGGCGCCAACCCGATAAAGTACGACCCCAGCAATCCCATCATC
CTCTTCATCGTTCAGGTATGCCTCCCGCTCGTCCCTCTTGTCAGCCTGCCGGCCCGCTCTGACGTACGGCTGCCA
GACGAGCCTGATCGTCATTGTCTGCCATGCCCTGCACTGGCCGCTCGCAAAGATCCGCCAGCCTCGCGTCATCGC
CGAGGTCGTGGGCGGCATCATCCTCGGCCCCTCCGTCATGGGCCGTGTCCCGGGCTTCCGCGACGCCATCTTCCC
CAAGGAATCCCTGCCCAACCTCAATCTTGTCGCCAACCTCGGCCTTGTCCTCTATCTCTTCCTCATCGGCCTCGA
GACCGATGTCCGCTTCCTCCTCCGCAATTGGCGCGTTGCCACCTCCGTCGCCTTCGCCGGCCTCGCCCTCCCCTT
CGCCATCGGCTGTGCCCTGGCCTGGGGCGTCTACAACGCCTTTCGCCAAGACGATGGCGTCCAGCCCATCAGCTT
CAGCACCTACATGCTCTTCATTGGCATCGCCATCGCCATCACCGTATGTCCCCCTCTCCCCTTTCCCTGCAAGAT
CCAGCTTGAGGCCCGAGCTCACCTCGCCTTACCAGGCCTTTCCCGTGCTTTGCCGTATCTTGACCGAGCTCAAGC
TTCTCGACACCCCGGTCGGAGTCATTACCCTGTCAGCCGGTGTCGCCAACGATGTTGTCGGTGAGTTTTCTCCCT
CGCTCCTCCTTTTATAGTCTGCTCGTCTTCATCCGCGATGGACGGCTTGGTCAGACCGGAAGCCTGCCGTCAGAT
GCTAATTAGACTGCCACCAAGGCTGGGTCTTACTTGCGCTTTGCGTCGCGCTCGTCAACGCCGGCAACGGCCTCT
CCGCCCTCTGGATCCTGCTCTCTTGTGTTGGGTTCATGCTCTTCCTGCTGTACCTTGTCCGGCCCGCCCTTTTCT
GGCTCCTTCGCCGCACCGGAAGCATCGAGCATGACCCCTCGCAGAGCGTCATCTCCCTCATTCTCCTCCTCGCCC
TGGCTTCGGCCTTCTTCACCGGCATCATCGGCGTCCACCCCATCTTCGGCGGCTTCATGGCTGGCCTCATCCTCC
CTCGCGAAAACAGGTTCAACATTCGCGTTACCGAGAAGCTCGAGGATCTCATAGGCGCCATCTTCCTGCCCCTAT
ACTTCACCCTGTCCGGTCTCAACACCAACCTCGGCCTGCTGAATTCGGGCATCACGTGGGGGTACGTCTTTGCCA
CCACCTTTGTGGCCTTCTTCACCAAAATCATCGGCGCTTCCCTTGCCGCTCGACTCAACGGCTTGGTGTGGCGGG
AATCCTTCACCATCGGCGTGCTCATGAGCTGCAAGGGCCTTGTGGAGCTGATTGTGCTTGTAAGTCGCACCGCCG
CTCACTCGACCCTGAAGACTGCGACGACGCACAGCGTCGTGTCATTGGCTGCTTTGAGTCGCCTCATTGGAGTCC
ATCATCATGGCCTCGATCCCGCTGCAGTCTGCGCACGCAATGCTGACCACCCGACTCCTGCGCGCAGAACATCGG
CCTTCAGGCCAACATTCTCAGCACGAGAACCTTCACCATCTTCGTCGTCATGGCCCTCCTCACCACCTTCACCAC
GACGCCCATCGTATCCGCCCTCTACCCACCCTGGTATCAGGCCAAGATCGCGGCCTGGAAGCGCGGGGAGATCGA
CTGGGAAACGGGCGCGCCCATCTCGTCCATGGACGGCGACGACGACGACAGTCAGAACAAGTCGGACGCCGTGAG
GCGAGTGGGCAAGGTGCTCGCGTACCTCCGACTCGACAGCATGCCGGCCCTGCTCAACCTGCTGTCCCTGTTCGG
GGGCCCCGAGGCGGCCTCGTCCCGATCCGTCGGAGGCAAGGACGTCTCGGAGGTCAGCGACGGCCGCGGCGCGGG
GCCTGTCTGGGTGCACGGCATGCGCCTGCTCCAGCTCACGGACCGCGACTCGTCCGTCATGACCGTGTCCCAGGT
CGCCGAGTACAGCCGCCACGACCCCATCGTCAACACGTTCCGCACCGTCGGCCGGCTCCACAACCTGGCCGTCTC
GGGCGAGGTGGCCATCATGCCCGAGGCGCGCTTCGCCGAGGCCCTCGTTGGCAAGGCGGCCGCCGTCTCGTCGGA
TATGATCCTCCTCCCCTGGAGCGAGACGGGCGGCATGGGTGACTCGCCCATCCTGTCGTCGGCCACGCTTGACGA
CAGGATGGCCTCGGGCTACGGCACCTTCGTCAAGGCCGTCCTCGACGCGCACGACCGCAGCATCGGCGTCTTCTT
CTCCCGCACCGACGAGGTCGGGCCCGACGGCTCGCCCGCGTCCTCGGACCGCCTCACCCTTTCGCGCCAGACGTC
GTTCGGCATCTCGGCCGCCGACGACCGCCCCGTCGCCTCCCGCCCCGCCAGGCCCTACCACGTCTTCGTGGCCTA
CTTCGGCGGCGACGACGACGTGCTGGCGCTTCGCCTAGCCCTCCAGCTGTGCGAGAACGCACAGGCCGCCGCCAC
GGTCGTGCGCGTCTCCGCCCCGGGGGGCGCCGACGCCTCCGCCGACGTCTTCGACATGATCCGCTCCCACGTCCC
GGCCGACGTGGCCGCCCGCGTCGACTTCAGCGTGGCCCCCGCCTCGACGACCATCCAGGACCTGGTGCGCCTGGC
CCTTCCGGGGCCAGATCGGAAGCGCGTCGTGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail