Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3696
Gene name
LocationContig_1998:2726..3574
Strand-
Gene length (bp)848
Transcript length (bp)507
Coding sequence length (bp)507
Protein length (aa) 169

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02936 COX4 Cytochrome c oxidase subunit IV 3.4E-47 27 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P06810|COX5_NEUCR Cytochrome c oxidase polypeptide 5, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cya-4 PE=3 SV=2 1 164 3.0E-68
sp|O93980|COX5_ASPNG Cytochrome c oxidase polypeptide 5, mitochondrial OS=Aspergillus niger GN=cox5 PE=3 SV=1 18 165 3.0E-61
sp|O74988|COX5_SCHPO Cytochrome c oxidase polypeptide 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox5 PE=3 SV=2 30 161 3.0E-36
sp|P00425|COX5B_YEAST Cytochrome c oxidase polypeptide 5B, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5B PE=1 SV=3 9 151 1.0E-25
sp|P00424|COX5A_YEAST Cytochrome c oxidase polypeptide 5A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5A PE=1 SV=1 9 151 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P06810|COX5_NEUCR Cytochrome c oxidase polypeptide 5, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cya-4 PE=3 SV=2 1 164 3.0E-68
sp|O93980|COX5_ASPNG Cytochrome c oxidase polypeptide 5, mitochondrial OS=Aspergillus niger GN=cox5 PE=3 SV=1 18 165 3.0E-61
sp|O74988|COX5_SCHPO Cytochrome c oxidase polypeptide 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cox5 PE=3 SV=2 30 161 3.0E-36
sp|P00425|COX5B_YEAST Cytochrome c oxidase polypeptide 5B, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5B PE=1 SV=3 9 151 1.0E-25
sp|P00424|COX5A_YEAST Cytochrome c oxidase polypeptide 5A, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX5A PE=1 SV=1 9 151 2.0E-21
sp|P53077|MTC3_YEAST Maintenance of telomere capping protein 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTC3 PE=1 SV=1 20 113 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004129 cytochrome-c oxidase activity Yes
GO:0008324 cation transmembrane transporter activity No
GO:0016491 oxidoreductase activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0016675 oxidoreductase activity, acting on a heme group of donors No
GO:0015002 heme-copper terminal oxidase activity No
GO:0003824 catalytic activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022857 transmembrane transporter activity No
GO:0016676 oxidoreductase activity, acting on a heme group of donors, oxygen as acceptor No
GO:0005215 transporter activity No
GO:0009055 electron transfer activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 98 120 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3696
MLRTSAFSLLRKGLVRSAPALSRTSSTHAISKPTLANIEKRWEDMPLQEQADLWMALRDRMKGNWNELTIQEKKA
AYWIAFGPHGPRAVDPAGTNARIAWGVVLGLGASLAIFGTIRSFARPEPDTMSREYQEAANEMLKQQRADPITGI
SSEGYSGRGQIQSPPKGH*
Coding >Hirsu2|3696
ATGCTGCGCACCTCGGCGTTCAGTCTGCTGCGGAAGGGGCTAGTGCGCAGCGCCCCTGCCCTCTCACGAACTTCG
TCCACCCATGCTATTTCCAAGCCGACCTTGGCCAACATCGAGAAACGATGGGAGGACATGCCTCTTCAAGAGCAA
GCTGACCTTTGGATGGCCCTGCGTGACCGCATGAAGGGCAACTGGAATGAGTTGACCATTCAGGAGAAGAAAGCT
GCCTACTGGATTGCATTTGGCCCTCACGGCCCCCGCGCCGTCGACCCCGCAGGGACCAACGCTCGCATTGCTTGG
GGCGTCGTGCTAGGCCTCGGCGCCAGCCTGGCTATCTTCGGCACCATCCGATCGTTTGCCAGACCTGAGCCAGAT
ACCATGTCACGAGAGTACCAGGAAGCAGCCAATGAGATGCTAAAACAACAAAGAGCGGATCCCATCACCGGTATC
TCTTCCGAGGGCTACTCTGGCCGAGGACAGATACAGTCGCCTCCAAAGGGTCACTAA
Transcript >Hirsu2|3696
ATGCTGCGCACCTCGGCGTTCAGTCTGCTGCGGAAGGGGCTAGTGCGCAGCGCCCCTGCCCTCTCACGAACTTCG
TCCACCCATGCTATTTCCAAGCCGACCTTGGCCAACATCGAGAAACGATGGGAGGACATGCCTCTTCAAGAGCAA
GCTGACCTTTGGATGGCCCTGCGTGACCGCATGAAGGGCAACTGGAATGAGTTGACCATTCAGGAGAAGAAAGCT
GCCTACTGGATTGCATTTGGCCCTCACGGCCCCCGCGCCGTCGACCCCGCAGGGACCAACGCTCGCATTGCTTGG
GGCGTCGTGCTAGGCCTCGGCGCCAGCCTGGCTATCTTCGGCACCATCCGATCGTTTGCCAGACCTGAGCCAGAT
ACCATGTCACGAGAGTACCAGGAAGCAGCCAATGAGATGCTAAAACAACAAAGAGCGGATCCCATCACCGGTATC
TCTTCCGAGGGCTACTCTGGCCGAGGACAGATACAGTCGCCTCCAAAGGGTCACTAA
Gene >Hirsu2|3696
ATGCTGCGCACCTCGGCGTTCAGTCTGCTGCGGAAGGGGCTAGTGCGCAGCGCCCCTGCCCTCTCACGAACTTCG
TCCACCCATGCTATTTCCAAGCCGACCTTGGCCAACATCGAGAAACGATGGGAGGACATGCCTCTTCAAGAGCAA
GCTGACCTTTGGATGGCCCTGCGTGACCGCATGAAGGGCAACTGGAATGAGTTGACCATTCAGGAGAAGAAAGCT
GGTGCGTCCTTCGAATAACCCCCCTGTTTTTAGTTGGGAAACAACGAATGCCTGCTTGCTTCATCGCTCTCGTCG
ATGCGAACCAGCCCTCGTTCTCTTGTGTTCCACCGCACCGCATGACGTGACATAGTCTCGCGTCAGCGGTCATCT
GATTATGAAGACTATTCTCTCTGTTCCCCGTACCTTCCCCCTCGTAGCCGAAGTGTCCATTGGGCCGCAGAAGTC
GTGTTGTGACCAAGCGACAAAAATCATATTGCCAGTCTCAGAAACTGACTTGATTCTTGTTACCAGCCTACTGGA
TTGCATTTGGCCCTCACGGCCCCCGCGCCGTCGACCCCGCAGGGACCAACGCTCGCATTGCTTGGGGCGTCGTGC
TAGGCCTCGGCGCCAGCCTGGCTATCTTCGGCACCATCCGATCGTTTGCCAGACCTGAGCCAGATACCATGTCAC
GAGAGTACCAGGAAGCAGCCAATGAGATGCTAAAAGTACGTAGACCTCGTTGTGTTTGAAGGGGCTTTCTGACAC
CTACTTTACAGCAACAAAGAGCGGATCCCATCACCGGTATCTCTTCCGAGGGCTACTCTGGCCGAGGACAGATAC
AGTCGCCTCCAAAGGGTCACTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail