Protein ID | Hirsu2|3695 |
Gene name | |
Location | Contig_1998:742..1674 |
Strand | + |
Gene length (bp) | 932 |
Transcript length (bp) | 780 |
Coding sequence length (bp) | 780 |
Protein length (aa) | 260 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF07724 | AAA_2 | AAA domain (Cdc48 subfamily) | 3.8E-25 | 128 | 236 |
PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 2.2E-12 | 131 | 234 |
PF07728 | AAA_5 | AAA domain (dynein-related subfamily) | 1.3E-06 | 130 | 206 |
PF00493 | MCM | MCM P-loop domain | 2.0E-05 | 125 | 208 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P38323|CLPX_YEAST | ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCX1 PE=1 SV=1 | 14 | 239 | 4.0E-51 |
sp|Q5U2U0|CLPX_RAT | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Rattus norvegicus GN=Clpx PE=2 SV=1 | 21 | 258 | 1.0E-44 |
sp|O76031|CLPX_HUMAN | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens GN=CLPX PE=1 SV=2 | 21 | 258 | 2.0E-44 |
sp|Q5R7N3|CLPX_PONAB | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Pongo abelii GN=CLPX PE=2 SV=1 | 21 | 258 | 2.0E-44 |
sp|Q9JHS4|CLPX_MOUSE | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus GN=Clpx PE=1 SV=2 | 21 | 258 | 6.0E-44 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P38323|CLPX_YEAST | ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCX1 PE=1 SV=1 | 14 | 239 | 4.0E-51 |
sp|Q5U2U0|CLPX_RAT | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Rattus norvegicus GN=Clpx PE=2 SV=1 | 21 | 258 | 1.0E-44 |
sp|O76031|CLPX_HUMAN | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens GN=CLPX PE=1 SV=2 | 21 | 258 | 2.0E-44 |
sp|Q5R7N3|CLPX_PONAB | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Pongo abelii GN=CLPX PE=2 SV=1 | 21 | 258 | 2.0E-44 |
sp|Q9JHS4|CLPX_MOUSE | ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus GN=Clpx PE=1 SV=2 | 21 | 258 | 6.0E-44 |
sp|B1XUS8|CLPX_POLNS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=clpX PE=3 SV=1 | 14 | 236 | 1.0E-39 |
sp|F4K7F6|CLPX2_ARATH | CLP protease regulatory subunit CLPX2, mitochondrial OS=Arabidopsis thaliana GN=CLPX2 PE=3 SV=1 | 14 | 238 | 1.0E-38 |
sp|Q7VP79|CLPX_HAEDU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-38 |
sp|A4SXD7|CLPX_POLSQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=clpX PE=3 SV=1 | 14 | 242 | 2.0E-38 |
sp|Q6AFZ6|CLPX_LEIXX | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=clpX PE=3 SV=1 | 3 | 242 | 2.0E-38 |
sp|A5WC69|CLPX_PSYWF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter sp. (strain PRwf-1) GN=clpX PE=3 SV=1 | 14 | 236 | 3.0E-38 |
sp|Q6A7F1|CLPX_PROAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=clpX PE=3 SV=1 | 14 | 242 | 6.0E-38 |
sp|Q7M8U5|CLPX2_WOLSU | ATP-dependent Clp protease ATP-binding subunit ClpX 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=clpX2 PE=3 SV=1 | 35 | 242 | 2.0E-37 |
sp|Q8G5R1|CLPX_BIFLO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bifidobacterium longum (strain NCC 2705) GN=clpX PE=3 SV=2 | 6 | 242 | 2.0E-37 |
sp|Q8FN57|CLPX_COREF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=clpX PE=3 SV=1 | 14 | 236 | 4.0E-37 |
sp|Q89AA0|CLPX_BUCBP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=clpX PE=3 SV=1 | 109 | 242 | 5.0E-37 |
sp|Q9FK07|CLPX1_ARATH | CLP protease regulatory subunit CLPX1, mitochondrial OS=Arabidopsis thaliana GN=CLPX1 PE=2 SV=1 | 14 | 242 | 5.0E-37 |
sp|B2GGB7|CLPX_KOCRD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=clpX PE=3 SV=1 | 14 | 242 | 2.0E-36 |
sp|B3E1Z3|CLPX_GEOLS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=clpX PE=3 SV=1 | 119 | 242 | 3.0E-36 |
sp|A6WDT9|CLPX_KINRD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=clpX PE=3 SV=1 | 115 | 242 | 4.0E-36 |
sp|Q4FQB8|CLPX_PSYA2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=clpX PE=3 SV=1 | 14 | 236 | 4.0E-36 |
sp|Q1IWD8|CLPX_DEIGD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Deinococcus geothermalis (strain DSM 11300) GN=clpX PE=3 SV=1 | 118 | 242 | 7.0E-36 |
sp|Q83DJ1|CLPX_COXBU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=clpX PE=3 SV=1 | 119 | 242 | 7.0E-36 |
sp|B6J0V9|CLPX_COXB2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain CbuG_Q212) GN=clpX PE=3 SV=1 | 119 | 242 | 7.0E-36 |
sp|B6J8W3|CLPX_COXB1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain CbuK_Q154) GN=clpX PE=3 SV=1 | 119 | 242 | 7.0E-36 |
sp|A1AN84|CLPX_PELPD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelobacter propionicus (strain DSM 2379) GN=clpX PE=3 SV=1 | 116 | 242 | 7.0E-36 |
sp|Q74C83|CLPX_GEOSL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=clpX PE=3 SV=1 | 116 | 242 | 7.0E-36 |
sp|A9NDF9|CLPX_COXBR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=clpX PE=3 SV=1 | 119 | 242 | 7.0E-36 |
sp|A9KDS7|CLPX_COXBN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain Dugway 5J108-111) GN=clpX PE=3 SV=1 | 119 | 242 | 7.0E-36 |
sp|Q39UH3|CLPX_GEOMG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=clpX PE=3 SV=1 | 116 | 242 | 1.0E-35 |
sp|Q1Q8J1|CLPX_PSYCK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter cryohalolentis (strain K5) GN=clpX PE=3 SV=1 | 14 | 236 | 1.0E-35 |
sp|A1SME0|CLPX_NOCSJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nocardioides sp. (strain BAA-499 / JS614) GN=clpX PE=3 SV=1 | 118 | 242 | 1.0E-35 |
sp|A5GFA1|CLPX_GEOUR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter uraniireducens (strain Rf4) GN=clpX PE=3 SV=1 | 116 | 242 | 2.0E-35 |
sp|B5YE53|CLPX_DICT6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=clpX PE=3 SV=1 | 124 | 232 | 2.0E-35 |
sp|Q8PBY5|CLPX_XANCP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=clpX PE=3 SV=1 | 116 | 236 | 2.0E-35 |
sp|B0RTF5|CLPX_XANCB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain B100) GN=clpX PE=3 SV=1 | 116 | 236 | 2.0E-35 |
sp|Q4URL5|CLPX_XANC8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain 8004) GN=clpX PE=3 SV=1 | 116 | 236 | 2.0E-35 |
sp|B8E291|CLPX_DICTD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=clpX PE=3 SV=1 | 124 | 232 | 2.0E-35 |
sp|B9M0Y2|CLPX_GEODF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=clpX PE=3 SV=1 | 116 | 242 | 2.0E-35 |
sp|A5CR08|CLPX_CLAM3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=clpX PE=3 SV=1 | 123 | 242 | 2.0E-35 |
sp|B0RAS4|CLPX_CLAMS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=clpX PE=3 SV=1 | 123 | 242 | 2.0E-35 |
sp|Q5H433|CLPX_XANOR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=clpX PE=3 SV=1 | 116 | 236 | 3.0E-35 |
sp|Q2P6Y9|CLPX_XANOM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=clpX PE=3 SV=1 | 116 | 236 | 3.0E-35 |
sp|B2SMI2|CLPX_XANOP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=clpX PE=3 SV=1 | 116 | 236 | 3.0E-35 |
sp|Q3BWQ0|CLPX_XANC5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=clpX PE=3 SV=1 | 116 | 236 | 3.0E-35 |
sp|Q8PNI4|CLPX_XANAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas axonopodis pv. citri (strain 306) GN=clpX PE=3 SV=1 | 116 | 236 | 3.0E-35 |
sp|A0R196|CLPX_MYCS2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=clpX PE=3 SV=1 | 119 | 242 | 3.0E-35 |
sp|A1TCB3|CLPX_MYCVP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=clpX PE=3 SV=1 | 119 | 242 | 3.0E-35 |
sp|A4T2N8|CLPX_MYCGI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium gilvum (strain PYR-GCK) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-35 |
sp|Q9CBY6|CLPX_MYCLE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium leprae (strain TN) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-35 |
sp|B8ZRP1|CLPX_MYCLB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium leprae (strain Br4923) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-35 |
sp|C4LJV6|CLPX_CORK4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=clpX PE=3 SV=1 | 14 | 236 | 4.0E-35 |
sp|Q60BE7|CLPX2_METCA | ATP-dependent Clp protease ATP-binding subunit ClpX 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=clpX2 PE=3 SV=1 | 118 | 236 | 4.0E-35 |
sp|A9WUW1|CLPX_RENSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=clpX PE=3 SV=1 | 124 | 242 | 4.0E-35 |
sp|Q5GS84|CLPX_WOLTR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=clpX PE=3 SV=1 | 118 | 232 | 4.0E-35 |
sp|Q8KFC3|CLPX_CHLTE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=clpX PE=3 SV=1 | 117 | 242 | 4.0E-35 |
sp|Q1B601|CLPX_MYCSS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain MCS) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-35 |
sp|A1UJ35|CLPX_MYCSK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain KMS) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-35 |
sp|A3Q2I1|CLPX_MYCSJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain JLS) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-35 |
sp|A0JXL2|CLPX_ARTS2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Arthrobacter sp. (strain FB24) GN=clpX PE=3 SV=1 | 124 | 242 | 4.0E-35 |
sp|O25926|CLPX_HELPY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=clpX PE=1 SV=1 | 14 | 242 | 4.0E-35 |
sp|Q5QXN9|CLPX_IDILO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-35 |
sp|A1U1Q2|CLPX_MARHV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=clpX PE=3 SV=1 | 122 | 236 | 5.0E-35 |
sp|C5CAX2|CLPX_MICLC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=clpX PE=3 SV=1 | 122 | 242 | 5.0E-35 |
sp|Q5Z061|CLPX_NOCFA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nocardia farcinica (strain IFM 10152) GN=clpX PE=3 SV=1 | 119 | 242 | 5.0E-35 |
sp|B9MQ33|CLPX_CALBD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=clpX PE=3 SV=1 | 119 | 236 | 5.0E-35 |
sp|Q9RSZ6|CLPX_DEIRA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=clpX PE=3 SV=1 | 126 | 232 | 5.0E-35 |
sp|B4SEI4|CLPX_PELPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=clpX PE=3 SV=1 | 123 | 242 | 5.0E-35 |
sp|C5BXF8|CLPX_BEUC1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-35 |
sp|Q8K989|CLPX_BUCAP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=clpX PE=3 SV=1 | 123 | 236 | 5.0E-35 |
sp|A4XHW1|CLPX_CALS8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=clpX PE=3 SV=1 | 124 | 236 | 5.0E-35 |
sp|B2A159|CLPX_NATTJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=clpX PE=3 SV=1 | 120 | 236 | 5.0E-35 |
sp|B8HA33|CLPX_ARTCA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-35 |
sp|C1AES4|CLPX_MYCBT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=clpX PE=3 SV=1 | 119 | 242 | 6.0E-35 |
sp|A1KLF3|CLPX_MYCBP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=clpX PE=3 SV=1 | 119 | 242 | 6.0E-35 |
sp|B2HNG2|CLPX_MYCMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=clpX PE=3 SV=1 | 119 | 236 | 6.0E-35 |
sp|A0PU31|CLPX_MYCUA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium ulcerans (strain Agy99) GN=clpX PE=3 SV=1 | 119 | 242 | 6.0E-35 |
sp|B0KBA3|CLPX_THEP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=clpX PE=3 SV=1 | 120 | 232 | 6.0E-35 |
sp|Q8RHJ9|CLPX_FUSNN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=clpX PE=3 SV=1 | 124 | 233 | 7.0E-35 |
sp|Q7MX10|CLPX_PORGI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=clpX PE=3 SV=1 | 124 | 236 | 7.0E-35 |
sp|B2RL24|CLPX_PORG3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=clpX PE=3 SV=1 | 124 | 236 | 7.0E-35 |
sp|A6X117|CLPX_OCHA4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=clpX PE=3 SV=1 | 119 | 236 | 7.0E-35 |
sp|B0K532|CLPX_THEPX | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermoanaerobacter sp. (strain X514) GN=clpX PE=3 SV=1 | 120 | 232 | 7.0E-35 |
sp|B1MXT8|CLPX_LEUCK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leuconostoc citreum (strain KM20) GN=clpX PE=3 SV=1 | 114 | 236 | 9.0E-35 |
sp|B1MMV6|CLPX_MYCA9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=clpX PE=3 SV=1 | 124 | 236 | 9.0E-35 |
sp|Q73XN1|CLPX_MYCPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=clpX PE=3 SV=1 | 119 | 242 | 9.0E-35 |
sp|A0QDF5|CLPX_MYCA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium avium (strain 104) GN=clpX PE=3 SV=1 | 119 | 242 | 9.0E-35 |
sp|B4EU54|CLPX_PROMH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Proteus mirabilis (strain HI4320) GN=clpX PE=3 SV=1 | 120 | 242 | 9.0E-35 |
sp|A0LSV2|CLPX_ACIC1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=clpX PE=3 SV=1 | 119 | 236 | 1.0E-34 |
sp|P9WPB9|CLPX_MYCTU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=clpX PE=1 SV=1 | 119 | 242 | 1.0E-34 |
sp|A5U5F3|CLPX_MYCTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=clpX PE=3 SV=1 | 119 | 242 | 1.0E-34 |
sp|P0A529|CLPX_MYCBO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=clpX PE=3 SV=1 | 119 | 242 | 1.0E-34 |
sp|C1A1N6|CLPX_RHOE4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-34 |
sp|C1AVQ3|CLPX_RHOOB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus opacus (strain B4) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-34 |
sp|Q0SGZ3|CLPX_RHOJR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus jostii (strain RHA1) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-34 |
sp|C3LNM5|CLPX_VIBCM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-34 |
sp|Q9KQS7|CLPX_VIBCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-34 |
sp|A5F6Z1|CLPX_VIBC3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-34 |
sp|Q60C67|CLPX1_METCA | ATP-dependent Clp protease ATP-binding subunit ClpX 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=clpX1 PE=3 SV=1 | 124 | 236 | 1.0E-34 |
sp|A8ZXB8|CLPX_DESOH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=clpX PE=3 SV=1 | 120 | 242 | 1.0E-34 |
sp|P57548|CLPX_BUCAI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-34 |
sp|B8D9Q3|CLPX_BUCA5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-34 |
sp|B3QPN4|CLPX_CHLP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobaculum parvum (strain NCIB 8327) GN=clpX PE=3 SV=1 | 117 | 242 | 1.0E-34 |
sp|B2S5W0|CLPX_BRUA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus (strain S19) GN=clpX PE=3 SV=1 | 119 | 236 | 1.0E-34 |
sp|Q55510|CLPX_SYNY3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpX PE=3 SV=1 | 14 | 242 | 1.0E-34 |
sp|B7VHZ9|CLPX_VIBTL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio tasmaniensis (strain LGP32) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-34 |
sp|Q0A6A8|CLPX_ALKEH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=clpX PE=3 SV=1 | 116 | 236 | 1.0E-34 |
sp|Q1QVW2|CLPX_CHRSD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-34 |
sp|Q83MI6|CLPX_TROW8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tropheryma whipplei (strain TW08/27) GN=clpX PE=3 SV=1 | 122 | 253 | 1.0E-34 |
sp|B8D805|CLPX_BUCAT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-34 |
sp|Q7MMG6|CLPX_VIBVY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio vulnificus (strain YJ016) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-34 |
sp|Q8DG27|CLPX_VIBVU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio vulnificus (strain CMCP6) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-34 |
sp|Q03W09|CLPX_LEUMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=clpX PE=3 SV=1 | 59 | 236 | 2.0E-34 |
sp|B4SLN2|CLPX_STRM5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Stenotrophomonas maltophilia (strain R551-3) GN=clpX PE=3 SV=1 | 116 | 236 | 2.0E-34 |
sp|Q87R79|CLPX_VIBPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-34 |
sp|C6E2S9|CLPX_GEOSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter sp. (strain M21) GN=clpX PE=3 SV=1 | 116 | 242 | 2.0E-34 |
sp|B5EI28|CLPX_GEOBB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=clpX PE=3 SV=1 | 116 | 242 | 2.0E-34 |
sp|Q5NH46|CLPX_FRATT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=clpX PE=3 SV=1 | 114 | 242 | 2.0E-34 |
sp|Q66GN9|CLPX3_ARATH | CLP protease regulatory subunit CLPX3, mitochondrial OS=Arabidopsis thaliana GN=CLPX3 PE=2 SV=1 | 14 | 242 | 2.0E-34 |
sp|A7MV82|CLPX_VIBCB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-34 |
sp|A6U7U8|CLPX_SINMW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sinorhizobium medicae (strain WSM419) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-34 |
sp|B1Y6H2|CLPX_LEPCP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=clpX PE=3 SV=1 | 117 | 242 | 2.0E-34 |
sp|Q73I60|CLPX_WOLPM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Wolbachia pipientis wMel GN=clpX PE=3 SV=1 | 118 | 232 | 2.0E-34 |
sp|Q92QQ2|CLPX_RHIME | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium meliloti (strain 1021) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-34 |
sp|C3MA45|CLPX_RHISN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium sp. (strain NGR234) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-34 |
sp|B8I8F6|CLPX_CLOCE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-34 |
sp|Q2SK35|CLPX_HAHCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Hahella chejuensis (strain KCTC 2396) GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-34 |
sp|B0U5N2|CLPX_XYLFM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain M12) GN=clpX PE=3 SV=1 | 98 | 236 | 2.0E-34 |
sp|B2FQR3|CLPX_STRMK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Stenotrophomonas maltophilia (strain K279a) GN=clpX PE=3 SV=1 | 116 | 236 | 2.0E-34 |
sp|Q83G50|CLPX_TROWT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tropheryma whipplei (strain Twist) GN=clpX PE=3 SV=1 | 122 | 253 | 2.0E-34 |
sp|Q2GFT9|CLPX_EHRCR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=clpX PE=3 SV=1 | 117 | 232 | 2.0E-34 |
sp|B5EQ29|CLPX_ACIF5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=clpX PE=3 SV=1 | 116 | 242 | 2.0E-34 |
sp|B7J791|CLPX_ACIF2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=clpX PE=3 SV=1 | 116 | 242 | 2.0E-34 |
sp|A9ISA8|CLPX_BART1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-34 |
sp|Q6FEP7|CLPX_ACIAD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-34 |
sp|A8EZR2|CLPX_RICCK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia canadensis (strain McKiel) GN=clpX PE=3 SV=1 | 122 | 236 | 3.0E-34 |
sp|Q0VQ89|CLPX_ALCBS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=clpX PE=3 SV=1 | 123 | 236 | 3.0E-34 |
sp|Q6LNW1|CLPX_PHOPR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Photobacterium profundum GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-34 |
sp|B9JVD6|CLPX_AGRVS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|A1BE59|CLPX_CHLPD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium phaeobacteroides (strain DSM 266) GN=clpX PE=3 SV=1 | 123 | 242 | 3.0E-34 |
sp|Q07ZX9|CLPX_SHEFN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella frigidimarina (strain NCIMB 400) GN=clpX PE=3 SV=1 | 124 | 242 | 3.0E-34 |
sp|A1W5B7|CLPX_ACISJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax sp. (strain JS42) GN=clpX PE=3 SV=1 | 116 | 236 | 3.0E-34 |
sp|B9MG15|CLPX_ACIET | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax ebreus (strain TPSY) GN=clpX PE=3 SV=1 | 116 | 236 | 3.0E-34 |
sp|Q87E50|CLPX_XYLFT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=clpX PE=3 SV=1 | 98 | 236 | 3.0E-34 |
sp|B2I8K4|CLPX_XYLF2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain M23) GN=clpX PE=3 SV=1 | 98 | 236 | 3.0E-34 |
sp|Q6G3Z2|CLPX_BARHE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|Q6G177|CLPX_BARQU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella quintana (strain Toulouse) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|Q1MIM6|CLPX_RHIL3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|O67356|CLPX_AQUAE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aquifex aeolicus (strain VF5) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-34 |
sp|A9M5C1|CLPX_BRUC2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|B5ZY09|CLPX_RHILW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|Q2K9U6|CLPX_RHIEC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|B3PVY5|CLPX_RHIE6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium etli (strain CIAT 652) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-34 |
sp|Q256C3|CLPX_CHLFF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila felis (strain Fe/C-56) GN=clpX PE=3 SV=1 | 123 | 242 | 4.0E-34 |
sp|Q9PE40|CLPX_XYLFA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain 9a5c) GN=clpX PE=3 SV=1 | 98 | 236 | 4.0E-34 |
sp|Q8G0I5|CLPX_BRUSU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella suis biovar 1 (strain 1330) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-34 |
sp|B0CGR0|CLPX_BRUSI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-34 |
sp|B0V4T7|CLPX_ACIBY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AYE) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-34 |
sp|A3M1Y8|CLPX_ACIBT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=clpX PE=3 SV=2 | 124 | 236 | 4.0E-34 |
sp|B0VKU4|CLPX_ACIBS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain SDF) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-34 |
sp|B2I3C2|CLPX_ACIBC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ACICU) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-34 |
sp|B7I5E4|CLPX_ACIB5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB0057) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-34 |
sp|B7H092|CLPX_ACIB3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB307-0294) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-34 |
sp|Q8YHC7|CLPX_BRUME | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-34 |
sp|C0RJ80|CLPX_BRUMB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-34 |
sp|Q9L7X5|CLPX_BRUAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus biovar 1 (strain 9-941) GN=clpX PE=3 SV=2 | 119 | 236 | 4.0E-34 |
sp|Q2YPX2|CLPX_BRUA2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus (strain 2308) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-34 |
sp|B2TPB8|CLPX_CLOBB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=clpX PE=3 SV=1 | 122 | 236 | 4.0E-34 |
sp|A5VQN3|CLPX_BRUO2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-34 |
sp|A4SM43|CLPX_AERS4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aeromonas salmonicida (strain A449) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-34 |
sp|B2UX12|CLPX_CLOBA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=clpX PE=3 SV=1 | 122 | 236 | 4.0E-34 |
sp|Q97FT7|CLPX_CLOAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=clpX PE=3 SV=1 | 114 | 236 | 4.0E-34 |
sp|A2BZ43|CLPX_PROM5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain MIT 9515) GN=clpX PE=3 SV=1 | 14 | 232 | 4.0E-34 |
sp|Q3YSQ2|CLPX_EHRCJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia canis (strain Jake) GN=clpX PE=3 SV=1 | 122 | 232 | 4.0E-34 |
sp|A1USA8|CLPX_BARBK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-34 |
sp|Q8F353|CLPX_LEPIN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=clpX PE=3 SV=1 | 120 | 232 | 5.0E-34 |
sp|Q72SG5|CLPX_LEPIC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=clpX PE=3 SV=1 | 120 | 232 | 5.0E-34 |
sp|B8FA63|CLPX_DESAA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfatibacillum alkenivorans (strain AK-01) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-34 |
sp|Q12LA2|CLPX_SHEDO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-34 |
sp|A8MIS7|CLPX_ALKOO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkaliphilus oremlandii (strain OhILAs) GN=clpX PE=3 SV=1 | 120 | 236 | 5.0E-34 |
sp|A0KJU2|CLPX_AERHH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=clpX PE=3 SV=1 | 119 | 242 | 5.0E-34 |
sp|P9WPB8|CLPX_MYCTO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=clpX PE=3 SV=1 | 119 | 242 | 5.0E-34 |
sp|B9DNC0|CLPX_STACT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus carnosus (strain TM300) GN=clpX PE=3 SV=1 | 120 | 236 | 5.0E-34 |
sp|A1RL88|CLPX_SHESW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain W3-18-1) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-34 |
sp|A4Y5I3|CLPX_SHEPC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-34 |
sp|Q5L4W6|CLPX_CHLAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=clpX PE=3 SV=1 | 123 | 242 | 5.0E-34 |
sp|Q0HTK8|CLPX_SHESR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain MR-7) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-34 |
sp|Q0HHA2|CLPX_SHESM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain MR-4) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-34 |
sp|A0KYL8|CLPX_SHESA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain ANA-3) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-34 |
sp|B1XN45|CLPX_SYNP2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=clpX PE=3 SV=1 | 14 | 242 | 5.0E-34 |
sp|Q5HBX4|CLPX_EHRRW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia ruminantium (strain Welgevonden) GN=clpX PE=3 SV=1 | 122 | 232 | 6.0E-34 |
sp|Q5FFG6|CLPX_EHRRG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia ruminantium (strain Gardel) GN=clpX PE=3 SV=1 | 122 | 232 | 6.0E-34 |
sp|Q180E8|CLPX_PEPD6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Peptoclostridium difficile (strain 630) GN=clpX PE=3 SV=1 | 118 | 232 | 6.0E-34 |
sp|Q5SKM7|CLPX_THET8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=clpX PE=3 SV=1 | 125 | 242 | 6.0E-34 |
sp|Q472D2|CLPX_CUPPJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=clpX PE=3 SV=1 | 120 | 242 | 6.0E-34 |
sp|Q8UFY5|CLPX_AGRFC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=clpX PE=3 SV=1 | 119 | 236 | 6.0E-34 |
sp|Q8EG18|CLPX_SHEON | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella oneidensis (strain MR-1) GN=clpX PE=3 SV=1 | 124 | 242 | 6.0E-34 |
sp|Q1LM63|CLPX_CUPMC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=clpX PE=3 SV=1 | 120 | 236 | 6.0E-34 |
sp|Q317Y5|CLPX_PROM9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain MIT 9312) GN=clpX PE=3 SV=1 | 14 | 232 | 6.0E-34 |
sp|B3R4W2|CLPX_CUPTR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=clpX PE=3 SV=1 | 120 | 242 | 6.0E-34 |
sp|Q0KBK3|CLPX_CUPNH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=clpX PE=3 SV=1 | 120 | 242 | 6.0E-34 |
sp|Q67SJ9|CLPX_SYMTH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=clpX PE=3 SV=1 | 119 | 236 | 6.0E-34 |
sp|Q3K9X0|CLPX_PSEPF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas fluorescens (strain Pf0-1) GN=clpX PE=3 SV=1 | 120 | 236 | 6.0E-34 |
sp|A6VW21|CLPX_MARMS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Marinomonas sp. (strain MWYL1) GN=clpX PE=3 SV=1 | 122 | 236 | 7.0E-34 |
sp|Q8XKK2|CLPX_CLOPE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain 13 / Type A) GN=clpX PE=3 SV=1 | 124 | 236 | 7.0E-34 |
sp|Q0TQK3|CLPX_CLOP1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=clpX PE=3 SV=1 | 124 | 236 | 7.0E-34 |
sp|Q0ST54|CLPX_CLOPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain SM101 / Type A) GN=clpX PE=3 SV=1 | 124 | 236 | 7.0E-34 |
sp|Q72L14|CLPX_THET2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=clpX PE=3 SV=1 | 125 | 242 | 7.0E-34 |
sp|A8GPK1|CLPX_RICAH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia akari (strain Hartford) GN=clpX PE=3 SV=1 | 124 | 236 | 7.0E-34 |
sp|Q21KA8|CLPX_SACD2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=clpX PE=3 SV=1 | 124 | 236 | 7.0E-34 |
sp|B1J693|CLPX_PSEPW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain W619) GN=clpX PE=3 SV=1 | 120 | 242 | 8.0E-34 |
sp|B0KJG7|CLPX_PSEPG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain GB-1) GN=clpX PE=3 SV=1 | 120 | 242 | 8.0E-34 |
sp|A9KWH8|CLPX_SHEB9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS195) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|A3D306|CLPX_SHEB5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|B8E5E8|CLPX_SHEB2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS223) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|Q7UZK6|CLPX_PROMP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=clpX PE=3 SV=1 | 14 | 232 | 8.0E-34 |
sp|A5W634|CLPX_PSEP1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=clpX PE=3 SV=1 | 120 | 236 | 8.0E-34 |
sp|Q3A3X6|CLPX_PELCD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|B8CY73|CLPX_HALOH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=clpX PE=3 SV=1 | 120 | 236 | 8.0E-34 |
sp|A6T5I1|CLPX_KLEP7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|B5Y0U1|CLPX_KLEP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Klebsiella pneumoniae (strain 342) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|A8G7G2|CLPX_PROM2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain MIT 9215) GN=clpX PE=3 SV=1 | 14 | 232 | 8.0E-34 |
sp|C4LDB4|CLPX_TOLAT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=clpX PE=3 SV=1 | 119 | 249 | 8.0E-34 |
sp|A6WLQ2|CLPX_SHEB8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS185) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|B7LME1|CLPX_ESCF3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|Q2GD18|CLPX_NEOSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Neorickettsia sennetsu (strain Miyayama) GN=clpX PE=3 SV=1 | 124 | 236 | 8.0E-34 |
sp|C5BTX7|CLPX_TERTT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=clpX PE=3 SV=1 | 123 | 236 | 8.0E-34 |
sp|B3PHK5|CLPX_CELJU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cellvibrio japonicus (strain Ueda107) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|Q325G3|CLPX_SHIBS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella boydii serotype 4 (strain Sb227) GN=clpX PE=3 SV=1 | 124 | 242 | 8.0E-34 |
sp|Q3Z4W5|CLPX_SHISS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella sonnei (strain Ss046) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|P0A6H4|CLPX_SHIFL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella flexneri GN=clpX PE=3 SV=2 | 124 | 242 | 9.0E-34 |
sp|Q0T7E5|CLPX_SHIF8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella flexneri serotype 5b (strain 8401) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|Q32JJ4|CLPX_SHIDS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B2U4P3|CLPX_SHIB3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|Q1RF97|CLPX_ECOUT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain UTI89 / UPEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B1LJJ5|CLPX_ECOSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B6HZP5|CLPX_ECOSE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain SE11) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B7N8Z2|CLPX_ECOLU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|P0A6H1|CLPX_ECOLI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12) GN=clpX PE=1 SV=2 | 124 | 242 | 9.0E-34 |
sp|B1J010|CLPX_ECOLC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|P0A6H2|CLPX_ECOL6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clpX PE=3 SV=2 | 124 | 242 | 9.0E-34 |
sp|Q0TKK3|CLPX_ECOL5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|A1A8A7|CLPX_ECOK1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O1:K1 / APEC GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|A7ZX96|CLPX_ECOHS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O9:H4 (strain HS) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B1XFM6|CLPX_ECODH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12 / DH10B) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|C4ZTJ5|CLPX_ECOBW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B7M3T1|CLPX_ECO8A | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O8 (strain IAI1) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B7MQF4|CLPX_ECO81 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O81 (strain ED1a) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B7NJ56|CLPX_ECO7I | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B5Z3U5|CLPX_ECO5E | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|P0A6H3|CLPX_ECO57 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O157:H7 GN=clpX PE=3 SV=2 | 124 | 242 | 9.0E-34 |
sp|B7L675|CLPX_ECO55 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain 55989 / EAEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B7MD97|CLPX_ECO45 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B7UJR1|CLPX_ECO27 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|A7ZIJ6|CLPX_ECO24 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|Q2GJB5|CLPX_ANAPZ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anaplasma phagocytophilum (strain HZ) GN=clpX PE=3 SV=1 | 122 | 232 | 9.0E-34 |
sp|C3JYJ9|CLPX_PSEFS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas fluorescens (strain SBW25) GN=clpX PE=3 SV=1 | 120 | 242 | 9.0E-34 |
sp|Q88KI9|CLPX_PSEPK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain KT2440) GN=clpX PE=3 SV=1 | 120 | 242 | 9.0E-34 |
sp|Q8ZRC0|CLPX_SALTY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B4TMC7|CLPX_SALSV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella schwarzengrund (strain CVM19633) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B5BD82|CLPX_SALPK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi A (strain AKU_12601) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|C0Q7X4|CLPX_SALPC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi C (strain RKS4594) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|A9MWX5|CLPX_SALPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|Q5PFN5|CLPX_SALPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B4SWU2|CLPX_SALNS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella newport (strain SL254) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B4T9E4|CLPX_SALHS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella heidelberg (strain SL476) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B5R6V0|CLPX_SALG2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B5FKV4|CLPX_SALDC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella dublin (strain CT_02021853) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|Q57SB4|CLPX_SALCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella choleraesuis (strain SC-B67) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|B5EXI9|CLPX_SALA4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella agona (strain SL483) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|A4XTZ6|CLPX_PSEMY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas mendocina (strain ymp) GN=clpX PE=3 SV=1 | 120 | 236 | 9.0E-34 |
sp|A7MFI7|CLPX_CROS8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|Q63V40|CLPX_BURPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain K96243) GN=clpX PE=3 SV=2 | 120 | 236 | 9.0E-34 |
sp|A3NAI4|CLPX_BURP6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain 668) GN=clpX PE=3 SV=1 | 120 | 236 | 9.0E-34 |
sp|A3NWA5|CLPX_BURP0 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain 1106a) GN=clpX PE=3 SV=1 | 120 | 236 | 9.0E-34 |
sp|B5QTJ7|CLPX_SALEP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella enteritidis PT4 (strain P125109) GN=clpX PE=3 SV=1 | 124 | 242 | 9.0E-34 |
sp|A8AK15|CLPX_CITK8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|A8F2I3|CLPX_RICM5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia massiliae (strain Mtu5) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-33 |
sp|Q4UMY8|CLPX_RICFE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-33 |
sp|A2SFB6|CLPX_METPP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylibium petroleiphilum (strain PM1) GN=clpX PE=3 SV=1 | 120 | 242 | 1.0E-33 |
sp|C5CJT5|CLPX_VARPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Variovorax paradoxus (strain S110) GN=clpX PE=3 SV=1 | 119 | 236 | 1.0E-33 |
sp|Q820F8|CLPX_STRAW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=clpX PE=3 SV=1 | 119 | 242 | 1.0E-33 |
sp|Q052U5|CLPX_LEPBL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=clpX PE=3 SV=1 | 120 | 232 | 1.0E-33 |
sp|Q04TR3|CLPX_LEPBJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=clpX PE=3 SV=1 | 120 | 232 | 1.0E-33 |
sp|A6LT28|CLPX_CLOB8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-33 |
sp|A4W7A9|CLPX_ENT38 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Enterobacter sp. (strain 638) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|Q8NW72|CLPX_STAAW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MW2) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q6G8Q1|CLPX_STAAS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MSSA476) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A1S4X6|CLPX_SHEAM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|A9MM22|CLPX_SALAR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|Q15R47|CLPX_PSEA6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-33 |
sp|Q7N0L4|CLPX_PHOLL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|Q8RC24|CLPX_CALS4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=clpX PE=3 SV=1 | 120 | 232 | 1.0E-33 |
sp|A4JF04|CLPX_BURVG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A8Z2J5|CLPX_STAAT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|P63790|CLPX_STAAN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain N315) GN=clpX PE=1 SV=1 | 120 | 236 | 1.0E-33 |
sp|P63789|CLPX_STAAM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A6QHK8|CLPX_STAAE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Newman) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q5HF98|CLPX_STAAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain COL) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A5ITJ9|CLPX_STAA9 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain JH9) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q2FXQ7|CLPX_STAA8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain NCTC 8325) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q2FG62|CLPX_STAA3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain USA300) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A6U2E2|CLPX_STAA2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain JH1) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A7X396|CLPX_STAA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q87YR7|CLPX_PSESM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|C5D5L4|CLPX_GEOSW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus sp. (strain WCH70) GN=clpX PE=3 SV=1 | 119 | 242 | 1.0E-33 |
sp|Q3JAJ9|CLPX_NITOC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A4SDM4|CLPX_CHLPM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|B9DU73|CLPX_STRU0 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=clpX PE=3 SV=1 | 123 | 236 | 1.0E-33 |
sp|A9AJR1|CLPX_BURM1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q5PBC9|CLPX_ANAMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anaplasma marginale (strain St. Maries) GN=clpX PE=3 SV=1 | 122 | 232 | 1.0E-33 |
sp|B9KHZ5|CLPX_ANAMF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anaplasma marginale (strain Florida) GN=clpX PE=3 SV=1 | 122 | 232 | 1.0E-33 |
sp|B1KLT6|CLPX_SHEWM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-33 |
sp|Q2SWQ5|CLPX_BURTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q5KWJ9|CLPX_GEOKA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus kaustophilus (strain HTA426) GN=clpX PE=3 SV=1 | 119 | 242 | 1.0E-33 |
sp|Q6GG31|CLPX_STAAR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MRSA252) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q2YTB5|CLPX_STAAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|B1JHS0|CLPX_YERPY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|A4TPE2|CLPX_YERPP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis (strain Pestoides F) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|Q1CL64|CLPX_YERPN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|A9QZQ2|CLPX_YERPG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Angola) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|Q8ZC66|CLPX_YERPE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|B2K6V8|CLPX_YERPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|Q1C4K9|CLPX_YERPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|A7FLC3|CLPX_YERP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|A3QFX5|CLPX_SHELP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|A1WUM6|CLPX_HALHL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|Q39FE9|CLPX_BURL3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q0BEF7|CLPX_BURCM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|B4EBM2|CLPX_BURCJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|A0K846|CLPX_BURCH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain HI2424) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|B1JTU9|CLPX_BURCC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain MC0-3) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q1BH84|CLPX_BURCA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain AU 1054) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|B1YRZ4|CLPX_BURA4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia ambifaria (strain MC40-6) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q4ZVM6|CLPX_PSEU2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas syringae pv. syringae (strain B728a) GN=clpX PE=3 SV=1 | 120 | 236 | 1.0E-33 |
sp|Q2NV78|CLPX_SODGM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sodalis glossinidius (strain morsitans) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|B2UFQ3|CLPX_RALPJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ralstonia pickettii (strain 12J) GN=clpX PE=3 SV=1 | 119 | 242 | 1.0E-33 |
sp|Q5E6Q4|CLPX_VIBF1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=clpX PE=3 SV=1 | 124 | 236 | 1.0E-33 |
sp|B8CRF6|CLPX_SHEPW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=clpX PE=3 SV=1 | 124 | 242 | 1.0E-33 |
sp|B5FBZ9|CLPX_VIBFM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio fischeri (strain MJ11) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|B3QWK0|CLPX_CHLT3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|B7JW74|CLPX_CYAP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cyanothece sp. (strain PCC 8801) GN=clpX PE=3 SV=1 | 115 | 242 | 2.0E-33 |
sp|B0UW19|CLPX_HISS2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Histophilus somni (strain 2336) GN=clpX PE=3 SV=1 | 122 | 236 | 2.0E-33 |
sp|A8FTI0|CLPX_SHESH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sediminis (strain HAW-EB3) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|B2JGL6|CLPX_BURP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-33 |
sp|Q0I4F0|CLPX_HAES1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Haemophilus somnus (strain 129Pt) GN=clpX PE=3 SV=1 | 122 | 236 | 2.0E-33 |
sp|Q65RF7|CLPX_MANSM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mannheimia succiniciproducens (strain MBEL55E) GN=clpX PE=3 SV=1 | 122 | 242 | 2.0E-33 |
sp|B0TLU8|CLPX_SHEHH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella halifaxensis (strain HAW-EB4) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|Q66DT3|CLPX_YERPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|B7GH25|CLPX_ANOFW | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-33 |
sp|A8H613|CLPX_SHEPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=clpX PE=3 SV=1 | 124 | 249 | 2.0E-33 |
sp|Q821L9|CLPX_CHLCV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila caviae (strain GPIC) GN=clpX PE=3 SV=1 | 123 | 242 | 2.0E-33 |
sp|A4IRH2|CLPX_GEOTN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus thermodenitrificans (strain NG80-2) GN=clpX PE=3 SV=1 | 119 | 242 | 2.0E-33 |
sp|Q13Z14|CLPX_BURXL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia xenovorans (strain LB400) GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-33 |
sp|Q8XYP6|CLPX_RALSO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ralstonia solanacearum (strain GMI1000) GN=clpX PE=3 SV=1 | 119 | 242 | 2.0E-33 |
sp|B0TFI7|CLPX_HELMI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-33 |
sp|B2T404|CLPX_BURPP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-33 |
sp|Q73M37|CLPX_TREDE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|Q9CGE6|CLPX_LACLA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|Q8DZ10|CLPX_STRA5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-33 |
sp|Q0RPH1|CLPX_FRAAA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia alni (strain ACN14a) GN=clpX PE=3 SV=1 | 123 | 236 | 2.0E-33 |
sp|Q8E4L8|CLPX_STRA3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype III (strain NEM316) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-33 |
sp|Q3K0K0|CLPX_STRA1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-33 |
sp|Q8DLI1|CLPX_THEEB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermosynechococcus elongatus (strain BP-1) GN=clpX PE=3 SV=1 | 123 | 242 | 2.0E-33 |
sp|Q9Z760|CLPX_CHLPN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia pneumoniae GN=clpX PE=3 SV=1 | 123 | 242 | 2.0E-33 |
sp|C6DB56|CLPX_PECCP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|C0ZAG3|CLPX_BREBN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-33 |
sp|A6SY75|CLPX_JANMA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Janthinobacterium sp. (strain Marseille) GN=clpX PE=3 SV=1 | 120 | 242 | 2.0E-33 |
sp|B8GNT9|CLPX_THISH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=clpX PE=3 SV=1 | 123 | 236 | 2.0E-33 |
sp|Q9K8F4|CLPX_BACHD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=clpX PE=3 SV=1 | 119 | 242 | 2.0E-33 |
sp|Q5FUR4|CLPX_GLUOX | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Gluconobacter oxydans (strain 621H) GN=clpX PE=3 SV=1 | 119 | 236 | 2.0E-33 |
sp|Q6D826|CLPX_PECAS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|O33873|CLPX_YEREN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia enterocolitica GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|A1JNN1|CLPX_YERE8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|P0DA37|CLPX_STRPQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|Q48U22|CLPX_STRPM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|Q1J741|CLPX_STRPF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|Q1JHC2|CLPX_STRPD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|P63795|CLPX_STRP8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|P0DA36|CLPX_STRP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|P63793|CLPX_STRP1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M1 GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|B3CQC6|CLPX_ORITI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Orientia tsutsugamushi (strain Ikeda) GN=clpX PE=3 SV=1 | 126 | 249 | 2.0E-33 |
sp|Q7MAS4|CLPX1_WOLSU | ATP-dependent Clp protease ATP-binding subunit ClpX 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=clpX1 PE=3 SV=1 | 126 | 242 | 2.0E-33 |
sp|A8GAR0|CLPX_SERP5 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Serratia proteamaculans (strain 568) GN=clpX PE=3 SV=1 | 124 | 242 | 2.0E-33 |
sp|Q48KY9|CLPX_PSE14 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-33 |
sp|Q2JDQ7|CLPX_FRASC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia sp. (strain CcI3) GN=clpX PE=3 SV=1 | 123 | 236 | 2.0E-33 |
sp|Q8GJP6|CLPX_LACLM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|A8L1X0|CLPX_FRASN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia sp. (strain EAN1pec) GN=clpX PE=3 SV=1 | 123 | 242 | 2.0E-33 |
sp|Q5XCM0|CLPX_STRP6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|A4G5X0|CLPX_HERAR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Herminiimonas arsenicoxydans GN=clpX PE=3 SV=1 | 120 | 236 | 2.0E-33 |
sp|Q9I2U0|CLPX_PSEAE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=clpX PE=3 SV=1 | 120 | 242 | 2.0E-33 |
sp|Q02KU5|CLPX_PSEAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=clpX PE=3 SV=1 | 120 | 242 | 2.0E-33 |
sp|B7VB75|CLPX_PSEA8 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain LESB58) GN=clpX PE=3 SV=1 | 120 | 242 | 2.0E-33 |
sp|A6V718|CLPX_PSEA7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain PA7) GN=clpX PE=3 SV=1 | 120 | 242 | 2.0E-33 |
sp|Q9PLM1|CLPX_CHLMU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpX PE=3 SV=1 | 123 | 242 | 2.0E-33 |
sp|B5XL03|CLPX_STRPZ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|A2RF17|CLPX_STRPG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|Q1JM77|CLPX_STRPC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|Q1JC93|CLPX_STRPB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|A1TM61|CLPX_ACIAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax citrulli (strain AAC00-1) GN=clpX PE=3 SV=1 | 116 | 236 | 2.0E-33 |
sp|B4U360|CLPX_STREM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=clpX PE=3 SV=1 | 124 | 236 | 2.0E-33 |
sp|A1VE84|CLPX_DESVV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=clpX PE=3 SV=1 | 122 | 242 | 2.0E-33 |
sp|Q72CE7|CLPX_DESVH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpX PE=3 SV=1 | 122 | 242 | 2.0E-33 |
sp|Q8D347|CLPX_WIGBR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Wigglesworthia glossinidia brevipalpis GN=clpX PE=3 SV=1 | 124 | 249 | 3.0E-33 |
sp|A5CDP2|CLPX_ORITB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Orientia tsutsugamushi (strain Boryong) GN=clpX PE=3 SV=1 | 126 | 249 | 3.0E-33 |
sp|A6TM62|CLPX_ALKMQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkaliphilus metalliredigens (strain QYMF) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-33 |
sp|Q68W45|CLPX_RICTY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|Q8Z8V1|CLPX_SALTI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella typhi GN=clpX PE=3 SV=1 | 124 | 242 | 3.0E-33 |
sp|Q3B5I8|CLPX_CHLL7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=clpX PE=3 SV=1 | 123 | 242 | 3.0E-33 |
sp|Q2RL30|CLPX_MOOTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Moorella thermoacetica (strain ATCC 39073) GN=clpX PE=3 SV=1 | 120 | 236 | 3.0E-33 |
sp|B1VXA8|CLPX_STRGG | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=clpX PE=3 SV=1 | 124 | 242 | 3.0E-33 |
sp|Q4L715|CLPX_STAHJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus haemolyticus (strain JCSC1435) GN=clpX PE=3 SV=1 | 123 | 236 | 3.0E-33 |
sp|Q92C84|CLPX_LISIN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=clpX PE=3 SV=1 | 119 | 242 | 3.0E-33 |
sp|Q5WEN9|CLPX_BACSK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus clausii (strain KSM-K16) GN=clpX PE=3 SV=1 | 98 | 236 | 3.0E-33 |
sp|C4K2L5|CLPX_RICPU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia peacockii (strain Rustic) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|A0AI71|CLPX_LISW6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=clpX PE=3 SV=1 | 119 | 242 | 3.0E-33 |
sp|C0MEW5|CLPX_STRS7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|C0M9R7|CLPX_STRE4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. equi (strain 4047) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|Q8Y7K9|CLPX_LISMO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-33 |
sp|B8DHN7|CLPX_LISMH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-33 |
sp|Q720F3|CLPX_LISMF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4b (strain F2365) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-33 |
sp|C1L2H6|CLPX_LISMC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-33 |
sp|O84711|CLPX_CHLTR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=clpX PE=3 SV=1 | 123 | 242 | 3.0E-33 |
sp|B0BAG0|CLPX_CHLTB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=clpX PE=3 SV=1 | 123 | 242 | 3.0E-33 |
sp|B0B8T1|CLPX_CHLT2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=clpX PE=3 SV=1 | 123 | 242 | 3.0E-33 |
sp|B1HVE5|CLPX_LYSSC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lysinibacillus sphaericus (strain C3-41) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-33 |
sp|A8GTC4|CLPX_RICRS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia rickettsii (strain Sheila Smith) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|B0BUW3|CLPX_RICRO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia rickettsii (strain Iowa) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|A4XAH9|CLPX_SALTO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=clpX PE=3 SV=1 | 116 | 242 | 3.0E-33 |
sp|P57981|CLPX_PASMU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pasteurella multocida (strain Pm70) GN=clpX PE=3 SV=1 | 122 | 242 | 3.0E-33 |
sp|Q9WXZ3|CLPX_THEMA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=clpX PE=3 SV=1 | 124 | 232 | 3.0E-33 |
sp|Q8CNY5|CLPX_STAES | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus epidermidis (strain ATCC 12228) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|Q5HNM9|CLPX_STAEQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|Q92GQ4|CLPX_RICCN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|C3PLG9|CLPX_RICAE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia africae (strain ESF-5) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|P50866|CLPX_BACSU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus subtilis (strain 168) GN=clpX PE=2 SV=3 | 119 | 236 | 3.0E-33 |
sp|Q47XL9|CLPX_COLP3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|A0Q2L0|CLPX_CLONN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium novyi (strain NT) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|Q82Y56|CLPX_NITEU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=clpX PE=3 SV=1 | 124 | 236 | 3.0E-33 |
sp|A7GTF1|CLPX_BACCN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=clpX PE=3 SV=1 | 119 | 236 | 3.0E-33 |
sp|Q5N1P7|CLPX_SYNP6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=clpX PE=3 SV=1 | 124 | 242 | 3.0E-33 |
sp|O34126|CLPX_SYNE7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus elongatus (strain PCC 7942) GN=clpX PE=3 SV=2 | 124 | 242 | 3.0E-33 |
sp|Q6AK60|CLPX_DESPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=clpX PE=3 SV=1 | 124 | 242 | 4.0E-33 |
sp|C3PI25|CLPX_CORA7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|Q6HD54|CLPX_BACHK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|Q633X2|CLPX_BACCZ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain ZK / E33L) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|B9IZ47|CLPX_BACCQ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain Q1) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|B7HQN2|CLPX_BACC7 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain AH187) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|C1ETR8|CLPX_BACC3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain 03BB102) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|Q72ZV4|CLPX_BACC1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|B7JQ65|CLPX_BACC0 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain AH820) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|Q81LB9|CLPX_BACAN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus anthracis GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|C3L704|CLPX_BACAC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|C3P9F7|CLPX_BACAA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus anthracis (strain A0248) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|Q1MQ78|CLPX_LAWIP | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=clpX PE=3 SV=1 | 112 | 242 | 4.0E-33 |
sp|Q9F316|CLPX_STRCO | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=clpX PE=3 SV=1 | 124 | 242 | 4.0E-33 |
sp|Q817Q2|CLPX_BACCR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|B7HEA4|CLPX_BACC4 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain B4264) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|B7IIY3|CLPX_BACC2 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain G9842) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|Q9ZCN1|CLPX_RICPR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia prowazekii (strain Madrid E) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|A7GIH1|CLPX_CLOBL | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|B1IND6|CLPX_CLOBK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Okra / Type B1) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|C1FLA5|CLPX_CLOBJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Kyoto / Type A2) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|A5I6W0|CLPX_CLOBH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|C3KU76|CLPX_CLOB6 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain 657 / Type Ba4) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|A7FYI1|CLPX_CLOB1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|A2BTN8|CLPX_PROMS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain AS9601) GN=clpX PE=3 SV=1 | 14 | 232 | 4.0E-33 |
sp|Q891J8|CLPX_CLOTE | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium tetani (strain Massachusetts / E88) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|A7Z7B2|CLPX_BACMF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=clpX PE=3 SV=1 | 119 | 236 | 4.0E-33 |
sp|A3DJ11|CLPX_CLOTH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=clpX PE=3 SV=1 | 120 | 236 | 4.0E-33 |
sp|B1L1D6|CLPX_CLOBM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|Q3KKY9|CLPX_CHLTA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=clpX PE=3 SV=1 | 128 | 242 | 4.0E-33 |
sp|Q49YA6|CLPX_STAS1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=clpX PE=3 SV=1 | 123 | 236 | 4.0E-33 |
sp|Q9X5N1|CLPX_MYXXA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Myxococcus xanthus GN=clpX PE=3 SV=1 | 124 | 242 | 4.0E-33 |
sp|A9C1U9|CLPX_DELAS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=clpX PE=3 SV=1 | 116 | 242 | 4.0E-33 |
sp|Q833M7|CLPX_ENTFA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=clpX PE=3 SV=1 | 124 | 236 | 4.0E-33 |
sp|Q2JLU2|CLPX_SYNJB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=clpX PE=3 SV=1 | 119 | 242 | 4.0E-33 |
sp|Q3M727|CLPX_ANAVT | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=clpX PE=3 SV=1 | 124 | 242 | 4.0E-33 |
sp|Q2Y6J1|CLPX_NITMU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=clpX PE=3 SV=1 | 119 | 242 | 5.0E-33 |
sp|P0CAU2|CLPX_CAUCR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=clpX PE=1 SV=1 | 119 | 242 | 5.0E-33 |
sp|B8GX14|CLPX_CAUCN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=clpX PE=3 SV=1 | 119 | 242 | 5.0E-33 |
sp|C0QHJ8|CLPX_DESAH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-33 |
sp|A8AXB9|CLPX_STRGC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=clpX PE=3 SV=1 | 117 | 236 | 5.0E-33 |
sp|B2S3A2|CLPX_TREPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema pallidum subsp. pallidum (strain SS14) GN=clpX PE=3 SV=1 | 124 | 236 | 5.0E-33 |
sp|O83521|CLPX_TREPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema pallidum (strain Nichols) GN=clpX PE=3 SV=1 | 124 | 236 | 5.0E-33 |
sp|Q11J59|CLPX_CHESB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chelativorans sp. (strain BNC1) GN=clpX PE=3 SV=1 | 120 | 236 | 5.0E-33 |
sp|A8M1K7|CLPX_SALAI | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salinispora arenicola (strain CNS-205) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-33 |
sp|B0SZ62|CLPX_CAUSK | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter sp. (strain K31) GN=clpX PE=3 SV=1 | 119 | 242 | 5.0E-33 |
sp|Q8YQX7|CLPX_NOSS1 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpX PE=3 SV=1 | 124 | 242 | 5.0E-33 |
sp|Q7W8X1|CLPX_BORPA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=clpX PE=3 SV=2 | 120 | 236 | 5.0E-33 |
sp|Q7WK82|CLPX_BORBR | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=clpX PE=3 SV=2 | 120 | 236 | 5.0E-33 |
sp|A0LDT3|CLPX_MAGMM | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=clpX PE=3 SV=1 | 122 | 236 | 5.0E-33 |
sp|Q12BY1|CLPX_POLSJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=clpX PE=3 SV=1 | 119 | 236 | 5.0E-33 |
sp|A5GQ09|CLPX_SYNR3 | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain RCC307) GN=clpX PE=3 SV=1 | 122 | 242 | 5.0E-33 |
sp|Q2JW64|CLPX_SYNJA | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain JA-3-3Ab) GN=clpX PE=3 SV=1 | 123 | 242 | 5.0E-33 |
sp|Q24SJ9|CLPX_DESHY | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfitobacterium hafniense (strain Y51) GN=clpX PE=3 SV=1 | 120 | 236 | 5.0E-33 |
sp|B8FVI0|CLPX_DESHD | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=clpX PE=3 SV=1 | 120 | 236 | 5.0E-33 |
sp|Q0AJI3|CLPX_NITEC | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosomonas eutropha (strain C91) GN=clpX PE=3 SV=1 | 124 | 236 | 5.0E-33 |
sp|B2IR87|CLPX_STRPS | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain CGSP14) GN=clpX PE=3 SV=1 | 124 | 236 | 5.0E-33 |
sp|B8ZLT1|CLPX_STRPJ | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=clpX PE=3 SV=1 | 124 | 236 | 5.0E-33 |
sp|Q256C3|CLPX_CHLFF | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila felis (strain Fe/C-56) GN=clpX PE=3 SV=1 | 14 | 54 | 1.0E-07 |
sp|Q5L4W6|CLPX_CHLAB | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=clpX PE=3 SV=1 | 14 | 54 | 2.0E-07 |
sp|Q821L9|CLPX_CHLCV | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila caviae (strain GPIC) GN=clpX PE=3 SV=1 | 14 | 54 | 2.0E-07 |
sp|Q9Z760|CLPX_CHLPN | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia pneumoniae GN=clpX PE=3 SV=1 | 14 | 54 | 6.0E-07 |
sp|Q9PLM1|CLPX_CHLMU | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpX PE=3 SV=1 | 14 | 54 | 3.0E-06 |
sp|B8GNT9|CLPX_THISH | ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=clpX PE=3 SV=1 | 14 | 56 | 5.0E-06 |
GO Term | Description | Terminal node |
---|---|---|
GO:0003677 | DNA binding | Yes |
GO:0005524 | ATP binding | Yes |
GO:0016887 | ATP hydrolysis activity | Yes |
GO:0032508 | DNA duplex unwinding | Yes |
GO:0008150 | biological_process | No |
GO:0032555 | purine ribonucleotide binding | No |
GO:0071103 | DNA conformation change | No |
GO:0005488 | binding | No |
GO:0003824 | catalytic activity | No |
GO:0016787 | hydrolase activity | No |
GO:0032392 | DNA geometric change | No |
GO:0016043 | cellular component organization | No |
GO:0036094 | small molecule binding | No |
GO:0003676 | nucleic acid binding | No |
GO:0017111 | nucleoside-triphosphatase activity | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0016462 | pyrophosphatase activity | No |
GO:0009987 | cellular process | No |
GO:0006996 | organelle organization | No |
GO:0017076 | purine nucleotide binding | No |
GO:0071840 | cellular component organization or biogenesis | No |
GO:0097367 | carbohydrate derivative binding | No |
GO:0051276 | chromosome organization | No |
GO:0003674 | molecular_function | No |
GO:0032553 | ribonucleotide binding | No |
GO:0043168 | anion binding | No |
GO:0000166 | nucleotide binding | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0032559 | adenyl ribonucleotide binding | No |
GO:0043167 | ion binding | No |
GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
GO:0035639 | purine ribonucleoside triphosphate binding | No |
GO:1901265 | nucleoside phosphate binding | No |
GO:0030554 | adenyl nucleotide binding | No |
GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Nucleus | Mitochondrial transit peptide|Nuclear export signal | 0.2952 | 0.6794 | 0.012 | 0.0339 | 0.4842 | 0.0245 | 0.2747 | 0.3678 | 0.2515 | 0.0319 |
Orthofinder run ID | 4 |
Orthogroup | 808 |
Change Orthofinder run |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|3695 MFSKASFGVPQFYPRDLKKRVDEYVVGQDRAKKTICCTLFNHYQNLRRRHQNEHEERNMQEKIMRQRLARDRELH QLRREMHPIEDGFPDHSNSVRLQREQNNTESHSLDHLYIPEDYSKPSHVKIDKSNLLLVGPTGVGKTYILETLSK KIQVPFSICDCNSLTQAGYIGQDVETCIERLLIEANYDVKATERGIVVLDEFDKLARRESPTGRDVGGEGVQQAL LKLVEGTKVTINVKDSRSSRSAPQTTTNFGSSGP* |
Coding | >Hirsu2|3695 ATGTTCAGCAAGGCCAGCTTCGGTGTTCCTCAATTTTACCCCCGAGATCTGAAGAAGCGAGTCGACGAATACGTC GTCGGCCAGGATCGAGCCAAGAAGACAATCTGCTGCACTTTGTTCAACCATTACCAGAACCTGCGCCGTAGACAC CAAAATGAGCACGAGGAAAGAAACATGCAAGAGAAGATCATGCGACAGAGACTTGCACGGGACAGGGAACTGCAC CAACTGCGCCGCGAGATGCACCCGATCGAAGATGGATTTCCGGATCACTCCAACTCTGTGCGGCTACAGCGTGAA CAGAATAATACCGAAAGCCATTCCCTCGACCATCTATATATTCCAGAGGACTATTCGAAGCCCAGTCACGTAAAG ATTGACAAGAGCAACCTTTTACTTGTTGGTCCAACAGGGGTCGGCAAGACCTACATACTAGAGACATTAAGCAAG AAAATTCAGGTCCCGTTCTCAATCTGCGATTGTAACTCCCTGACCCAGGCAGGGTATATTGGACAGGACGTGGAA ACATGCATTGAGCGTCTGTTGATAGAGGCCAATTACGATGTCAAGGCAACGGAACGTGGCATAGTAGTCTTGGAC GAGTTCGACAAGCTAGCCCGACGAGAATCCCCGACCGGCCGCGATGTCGGCGGCGAGGGCGTCCAGCAAGCGCTT CTGAAACTGGTCGAGGGTACCAAGGTCACCATCAATGTCAAGGACAGCCGATCATCGCGATCAGCGCCGCAAACA ACGACCAACTTCGGCTCCTCCGGGCCTTGA |
Transcript | >Hirsu2|3695 ATGTTCAGCAAGGCCAGCTTCGGTGTTCCTCAATTTTACCCCCGAGATCTGAAGAAGCGAGTCGACGAATACGTC GTCGGCCAGGATCGAGCCAAGAAGACAATCTGCTGCACTTTGTTCAACCATTACCAGAACCTGCGCCGTAGACAC CAAAATGAGCACGAGGAAAGAAACATGCAAGAGAAGATCATGCGACAGAGACTTGCACGGGACAGGGAACTGCAC CAACTGCGCCGCGAGATGCACCCGATCGAAGATGGATTTCCGGATCACTCCAACTCTGTGCGGCTACAGCGTGAA CAGAATAATACCGAAAGCCATTCCCTCGACCATCTATATATTCCAGAGGACTATTCGAAGCCCAGTCACGTAAAG ATTGACAAGAGCAACCTTTTACTTGTTGGTCCAACAGGGGTCGGCAAGACCTACATACTAGAGACATTAAGCAAG AAAATTCAGGTCCCGTTCTCAATCTGCGATTGTAACTCCCTGACCCAGGCAGGGTATATTGGACAGGACGTGGAA ACATGCATTGAGCGTCTGTTGATAGAGGCCAATTACGATGTCAAGGCAACGGAACGTGGCATAGTAGTCTTGGAC GAGTTCGACAAGCTAGCCCGACGAGAATCCCCGACCGGCCGCGATGTCGGCGGCGAGGGCGTCCAGCAAGCGCTT CTGAAACTGGTCGAGGGTACCAAGGTCACCATCAATGTCAAGGACAGCCGATCATCGCGATCAGCGCCGCAAACA ACGACCAACTTCGGCTCCTCCGGGCCTTGA |
Gene | >Hirsu2|3695 ATGTTCAGCAAGGCCAGCTTCGGTGTTCCTCAATTTTACCCCCGAGATCTGAAGAAGCGAGTCGACGAATACGTC GTCGGCCAGGATCGAGCCAAGAAGACAATCTGCTGCACTTTGTTCAACCATTACCAGAACCTGCGCCGTAGACAC CAAAATGAGCACGAGGAAAGAAACATGCAAGAGAAGATCATGCGACAGAGACTTGCACGGGACAGGGAACTGCAC CAACTGCGCCGCGAGATGCACCCGATCGAAGGTCAGTCAGCATCCTCCGAACATGCACAGCTCAGTGCCGCTGAT CAAATAAATCAAGATGGATTTCCGGATCACTCCAACTCTGTGCGGCTACAGCGTGAACAGAATAATACCGAAAGC CATTCCCTCGACCATCTATATATTCCAGAGGACTATTCGAAGCCCAGTCACGTAAAGATTGACAAGAGCAACCTT TTACTTGTTGGTCCAACAGGGGTCGGCAAGACCTACATACTAGAGTAAGTTGACTGCCGGGTCAGTCGATCTGGA TGTTCAGACTGAAAACGACGTAGGACATTAAGCAAGAAAATTCAGGTCCCGTTCTCAATCTGCGATTGTAACTCC CTGACCCAGGCAGGGTATATTGGACAGGACGTGGAAACATGCATTGAGCGTCTGTTGATAGAGGCCAATTACGAT GTCAAGGCAACGGAACGTGGCATAGTAGTCTTGGACGAGTTCGACAAGCTAGCCCGACGAGAATCCCCGACCGGC CGCGATGTCGGCGGCGAGGGCGTCCAGCAAGCGCTTCTGAAACTGGTCGAGGGTACCAAGGTCACCATCAATGTC AAGGACAGCCGATCATCGCGATCAGCGCCGCAAACAACGACCAACTTCGGCTCCTCCGGGCCGTCTTCCTCGTCG CCTCAAGGTGCTCCTCCCACTGGCAAAGTTGA |