Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3695
Gene name
LocationContig_1998:742..1674
Strand+
Gene length (bp)932
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 3.8E-25 128 236
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.2E-12 131 234
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.3E-06 130 206
PF00493 MCM MCM P-loop domain 2.0E-05 125 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38323|CLPX_YEAST ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCX1 PE=1 SV=1 14 239 4.0E-51
sp|Q5U2U0|CLPX_RAT ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Rattus norvegicus GN=Clpx PE=2 SV=1 21 258 1.0E-44
sp|O76031|CLPX_HUMAN ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens GN=CLPX PE=1 SV=2 21 258 2.0E-44
sp|Q5R7N3|CLPX_PONAB ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Pongo abelii GN=CLPX PE=2 SV=1 21 258 2.0E-44
sp|Q9JHS4|CLPX_MOUSE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus GN=Clpx PE=1 SV=2 21 258 6.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38323|CLPX_YEAST ATP-dependent clpX-like chaperone, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCX1 PE=1 SV=1 14 239 4.0E-51
sp|Q5U2U0|CLPX_RAT ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Rattus norvegicus GN=Clpx PE=2 SV=1 21 258 1.0E-44
sp|O76031|CLPX_HUMAN ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Homo sapiens GN=CLPX PE=1 SV=2 21 258 2.0E-44
sp|Q5R7N3|CLPX_PONAB ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Pongo abelii GN=CLPX PE=2 SV=1 21 258 2.0E-44
sp|Q9JHS4|CLPX_MOUSE ATP-dependent Clp protease ATP-binding subunit clpX-like, mitochondrial OS=Mus musculus GN=Clpx PE=1 SV=2 21 258 6.0E-44
sp|B1XUS8|CLPX_POLNS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=clpX PE=3 SV=1 14 236 1.0E-39
sp|F4K7F6|CLPX2_ARATH CLP protease regulatory subunit CLPX2, mitochondrial OS=Arabidopsis thaliana GN=CLPX2 PE=3 SV=1 14 238 1.0E-38
sp|Q7VP79|CLPX_HAEDU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=clpX PE=3 SV=1 124 242 2.0E-38
sp|A4SXD7|CLPX_POLSQ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=clpX PE=3 SV=1 14 242 2.0E-38
sp|Q6AFZ6|CLPX_LEIXX ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=clpX PE=3 SV=1 3 242 2.0E-38
sp|A5WC69|CLPX_PSYWF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter sp. (strain PRwf-1) GN=clpX PE=3 SV=1 14 236 3.0E-38
sp|Q6A7F1|CLPX_PROAC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=clpX PE=3 SV=1 14 242 6.0E-38
sp|Q7M8U5|CLPX2_WOLSU ATP-dependent Clp protease ATP-binding subunit ClpX 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=clpX2 PE=3 SV=1 35 242 2.0E-37
sp|Q8G5R1|CLPX_BIFLO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bifidobacterium longum (strain NCC 2705) GN=clpX PE=3 SV=2 6 242 2.0E-37
sp|Q8FN57|CLPX_COREF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=clpX PE=3 SV=1 14 236 4.0E-37
sp|Q89AA0|CLPX_BUCBP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=clpX PE=3 SV=1 109 242 5.0E-37
sp|Q9FK07|CLPX1_ARATH CLP protease regulatory subunit CLPX1, mitochondrial OS=Arabidopsis thaliana GN=CLPX1 PE=2 SV=1 14 242 5.0E-37
sp|B2GGB7|CLPX_KOCRD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=clpX PE=3 SV=1 14 242 2.0E-36
sp|B3E1Z3|CLPX_GEOLS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=clpX PE=3 SV=1 119 242 3.0E-36
sp|A6WDT9|CLPX_KINRD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=clpX PE=3 SV=1 115 242 4.0E-36
sp|Q4FQB8|CLPX_PSYA2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=clpX PE=3 SV=1 14 236 4.0E-36
sp|Q1IWD8|CLPX_DEIGD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Deinococcus geothermalis (strain DSM 11300) GN=clpX PE=3 SV=1 118 242 7.0E-36
sp|Q83DJ1|CLPX_COXBU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=clpX PE=3 SV=1 119 242 7.0E-36
sp|B6J0V9|CLPX_COXB2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain CbuG_Q212) GN=clpX PE=3 SV=1 119 242 7.0E-36
sp|B6J8W3|CLPX_COXB1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain CbuK_Q154) GN=clpX PE=3 SV=1 119 242 7.0E-36
sp|A1AN84|CLPX_PELPD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelobacter propionicus (strain DSM 2379) GN=clpX PE=3 SV=1 116 242 7.0E-36
sp|Q74C83|CLPX_GEOSL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=clpX PE=3 SV=1 116 242 7.0E-36
sp|A9NDF9|CLPX_COXBR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=clpX PE=3 SV=1 119 242 7.0E-36
sp|A9KDS7|CLPX_COXBN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Coxiella burnetii (strain Dugway 5J108-111) GN=clpX PE=3 SV=1 119 242 7.0E-36
sp|Q39UH3|CLPX_GEOMG ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=clpX PE=3 SV=1 116 242 1.0E-35
sp|Q1Q8J1|CLPX_PSYCK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Psychrobacter cryohalolentis (strain K5) GN=clpX PE=3 SV=1 14 236 1.0E-35
sp|A1SME0|CLPX_NOCSJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nocardioides sp. (strain BAA-499 / JS614) GN=clpX PE=3 SV=1 118 242 1.0E-35
sp|A5GFA1|CLPX_GEOUR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter uraniireducens (strain Rf4) GN=clpX PE=3 SV=1 116 242 2.0E-35
sp|B5YE53|CLPX_DICT6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=clpX PE=3 SV=1 124 232 2.0E-35
sp|Q8PBY5|CLPX_XANCP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=clpX PE=3 SV=1 116 236 2.0E-35
sp|B0RTF5|CLPX_XANCB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain B100) GN=clpX PE=3 SV=1 116 236 2.0E-35
sp|Q4URL5|CLPX_XANC8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. campestris (strain 8004) GN=clpX PE=3 SV=1 116 236 2.0E-35
sp|B8E291|CLPX_DICTD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=clpX PE=3 SV=1 124 232 2.0E-35
sp|B9M0Y2|CLPX_GEODF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=clpX PE=3 SV=1 116 242 2.0E-35
sp|A5CR08|CLPX_CLAM3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=clpX PE=3 SV=1 123 242 2.0E-35
sp|B0RAS4|CLPX_CLAMS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=clpX PE=3 SV=1 123 242 2.0E-35
sp|Q5H433|CLPX_XANOR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=clpX PE=3 SV=1 116 236 3.0E-35
sp|Q2P6Y9|CLPX_XANOM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=clpX PE=3 SV=1 116 236 3.0E-35
sp|B2SMI2|CLPX_XANOP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=clpX PE=3 SV=1 116 236 3.0E-35
sp|Q3BWQ0|CLPX_XANC5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=clpX PE=3 SV=1 116 236 3.0E-35
sp|Q8PNI4|CLPX_XANAC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xanthomonas axonopodis pv. citri (strain 306) GN=clpX PE=3 SV=1 116 236 3.0E-35
sp|A0R196|CLPX_MYCS2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=clpX PE=3 SV=1 119 242 3.0E-35
sp|A1TCB3|CLPX_MYCVP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=clpX PE=3 SV=1 119 242 3.0E-35
sp|A4T2N8|CLPX_MYCGI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium gilvum (strain PYR-GCK) GN=clpX PE=3 SV=1 119 242 4.0E-35
sp|Q9CBY6|CLPX_MYCLE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium leprae (strain TN) GN=clpX PE=3 SV=1 119 242 4.0E-35
sp|B8ZRP1|CLPX_MYCLB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium leprae (strain Br4923) GN=clpX PE=3 SV=1 119 242 4.0E-35
sp|C4LJV6|CLPX_CORK4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=clpX PE=3 SV=1 14 236 4.0E-35
sp|Q60BE7|CLPX2_METCA ATP-dependent Clp protease ATP-binding subunit ClpX 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=clpX2 PE=3 SV=1 118 236 4.0E-35
sp|A9WUW1|CLPX_RENSM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=clpX PE=3 SV=1 124 242 4.0E-35
sp|Q5GS84|CLPX_WOLTR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=clpX PE=3 SV=1 118 232 4.0E-35
sp|Q8KFC3|CLPX_CHLTE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=clpX PE=3 SV=1 117 242 4.0E-35
sp|Q1B601|CLPX_MYCSS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain MCS) GN=clpX PE=3 SV=1 119 242 4.0E-35
sp|A1UJ35|CLPX_MYCSK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain KMS) GN=clpX PE=3 SV=1 119 242 4.0E-35
sp|A3Q2I1|CLPX_MYCSJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium sp. (strain JLS) GN=clpX PE=3 SV=1 119 242 4.0E-35
sp|A0JXL2|CLPX_ARTS2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Arthrobacter sp. (strain FB24) GN=clpX PE=3 SV=1 124 242 4.0E-35
sp|O25926|CLPX_HELPY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=clpX PE=1 SV=1 14 242 4.0E-35
sp|Q5QXN9|CLPX_IDILO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=clpX PE=3 SV=1 119 242 4.0E-35
sp|A1U1Q2|CLPX_MARHV ATP-dependent Clp protease ATP-binding subunit ClpX OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=clpX PE=3 SV=1 122 236 5.0E-35
sp|C5CAX2|CLPX_MICLC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=clpX PE=3 SV=1 122 242 5.0E-35
sp|Q5Z061|CLPX_NOCFA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nocardia farcinica (strain IFM 10152) GN=clpX PE=3 SV=1 119 242 5.0E-35
sp|B9MQ33|CLPX_CALBD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=clpX PE=3 SV=1 119 236 5.0E-35
sp|Q9RSZ6|CLPX_DEIRA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=clpX PE=3 SV=1 126 232 5.0E-35
sp|B4SEI4|CLPX_PELPB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=clpX PE=3 SV=1 123 242 5.0E-35
sp|C5BXF8|CLPX_BEUC1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=clpX PE=3 SV=1 124 242 5.0E-35
sp|Q8K989|CLPX_BUCAP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=clpX PE=3 SV=1 123 236 5.0E-35
sp|A4XHW1|CLPX_CALS8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=clpX PE=3 SV=1 124 236 5.0E-35
sp|B2A159|CLPX_NATTJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=clpX PE=3 SV=1 120 236 5.0E-35
sp|B8HA33|CLPX_ARTCA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=clpX PE=3 SV=1 124 242 5.0E-35
sp|C1AES4|CLPX_MYCBT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=clpX PE=3 SV=1 119 242 6.0E-35
sp|A1KLF3|CLPX_MYCBP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=clpX PE=3 SV=1 119 242 6.0E-35
sp|B2HNG2|CLPX_MYCMM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=clpX PE=3 SV=1 119 236 6.0E-35
sp|A0PU31|CLPX_MYCUA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium ulcerans (strain Agy99) GN=clpX PE=3 SV=1 119 242 6.0E-35
sp|B0KBA3|CLPX_THEP3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=clpX PE=3 SV=1 120 232 6.0E-35
sp|Q8RHJ9|CLPX_FUSNN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=clpX PE=3 SV=1 124 233 7.0E-35
sp|Q7MX10|CLPX_PORGI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=clpX PE=3 SV=1 124 236 7.0E-35
sp|B2RL24|CLPX_PORG3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=clpX PE=3 SV=1 124 236 7.0E-35
sp|A6X117|CLPX_OCHA4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=clpX PE=3 SV=1 119 236 7.0E-35
sp|B0K532|CLPX_THEPX ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermoanaerobacter sp. (strain X514) GN=clpX PE=3 SV=1 120 232 7.0E-35
sp|B1MXT8|CLPX_LEUCK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leuconostoc citreum (strain KM20) GN=clpX PE=3 SV=1 114 236 9.0E-35
sp|B1MMV6|CLPX_MYCA9 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=clpX PE=3 SV=1 124 236 9.0E-35
sp|Q73XN1|CLPX_MYCPA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=clpX PE=3 SV=1 119 242 9.0E-35
sp|A0QDF5|CLPX_MYCA1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium avium (strain 104) GN=clpX PE=3 SV=1 119 242 9.0E-35
sp|B4EU54|CLPX_PROMH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Proteus mirabilis (strain HI4320) GN=clpX PE=3 SV=1 120 242 9.0E-35
sp|A0LSV2|CLPX_ACIC1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=clpX PE=3 SV=1 119 236 1.0E-34
sp|P9WPB9|CLPX_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=clpX PE=1 SV=1 119 242 1.0E-34
sp|A5U5F3|CLPX_MYCTA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=clpX PE=3 SV=1 119 242 1.0E-34
sp|P0A529|CLPX_MYCBO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=clpX PE=3 SV=1 119 242 1.0E-34
sp|C1A1N6|CLPX_RHOE4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=clpX PE=3 SV=1 124 242 1.0E-34
sp|C1AVQ3|CLPX_RHOOB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus opacus (strain B4) GN=clpX PE=3 SV=1 124 236 1.0E-34
sp|Q0SGZ3|CLPX_RHOJR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhodococcus jostii (strain RHA1) GN=clpX PE=3 SV=1 124 236 1.0E-34
sp|C3LNM5|CLPX_VIBCM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain M66-2) GN=clpX PE=3 SV=1 124 236 1.0E-34
sp|Q9KQS7|CLPX_VIBCH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=clpX PE=3 SV=1 124 236 1.0E-34
sp|A5F6Z1|CLPX_VIBC3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=clpX PE=3 SV=1 124 236 1.0E-34
sp|Q60C67|CLPX1_METCA ATP-dependent Clp protease ATP-binding subunit ClpX 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=clpX1 PE=3 SV=1 124 236 1.0E-34
sp|A8ZXB8|CLPX_DESOH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=clpX PE=3 SV=1 120 242 1.0E-34
sp|P57548|CLPX_BUCAI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=clpX PE=3 SV=1 120 236 1.0E-34
sp|B8D9Q3|CLPX_BUCA5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=clpX PE=3 SV=1 120 236 1.0E-34
sp|B3QPN4|CLPX_CHLP8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobaculum parvum (strain NCIB 8327) GN=clpX PE=3 SV=1 117 242 1.0E-34
sp|B2S5W0|CLPX_BRUA1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus (strain S19) GN=clpX PE=3 SV=1 119 236 1.0E-34
sp|Q55510|CLPX_SYNY3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=clpX PE=3 SV=1 14 242 1.0E-34
sp|B7VHZ9|CLPX_VIBTL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio tasmaniensis (strain LGP32) GN=clpX PE=3 SV=1 124 236 1.0E-34
sp|Q0A6A8|CLPX_ALKEH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=clpX PE=3 SV=1 116 236 1.0E-34
sp|Q1QVW2|CLPX_CHRSD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=clpX PE=3 SV=1 120 236 1.0E-34
sp|Q83MI6|CLPX_TROW8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tropheryma whipplei (strain TW08/27) GN=clpX PE=3 SV=1 122 253 1.0E-34
sp|B8D805|CLPX_BUCAT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=clpX PE=3 SV=1 120 236 2.0E-34
sp|Q7MMG6|CLPX_VIBVY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio vulnificus (strain YJ016) GN=clpX PE=3 SV=1 124 242 2.0E-34
sp|Q8DG27|CLPX_VIBVU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio vulnificus (strain CMCP6) GN=clpX PE=3 SV=1 124 242 2.0E-34
sp|Q03W09|CLPX_LEUMM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=clpX PE=3 SV=1 59 236 2.0E-34
sp|B4SLN2|CLPX_STRM5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Stenotrophomonas maltophilia (strain R551-3) GN=clpX PE=3 SV=1 116 236 2.0E-34
sp|Q87R79|CLPX_VIBPA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=clpX PE=3 SV=1 124 242 2.0E-34
sp|C6E2S9|CLPX_GEOSM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter sp. (strain M21) GN=clpX PE=3 SV=1 116 242 2.0E-34
sp|B5EI28|CLPX_GEOBB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=clpX PE=3 SV=1 116 242 2.0E-34
sp|Q5NH46|CLPX_FRATT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=clpX PE=3 SV=1 114 242 2.0E-34
sp|Q66GN9|CLPX3_ARATH CLP protease regulatory subunit CLPX3, mitochondrial OS=Arabidopsis thaliana GN=CLPX3 PE=2 SV=1 14 242 2.0E-34
sp|A7MV82|CLPX_VIBCB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=clpX PE=3 SV=1 124 242 2.0E-34
sp|A6U7U8|CLPX_SINMW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sinorhizobium medicae (strain WSM419) GN=clpX PE=3 SV=1 119 236 2.0E-34
sp|B1Y6H2|CLPX_LEPCP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=clpX PE=3 SV=1 117 242 2.0E-34
sp|Q73I60|CLPX_WOLPM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Wolbachia pipientis wMel GN=clpX PE=3 SV=1 118 232 2.0E-34
sp|Q92QQ2|CLPX_RHIME ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium meliloti (strain 1021) GN=clpX PE=3 SV=1 119 236 2.0E-34
sp|C3MA45|CLPX_RHISN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium sp. (strain NGR234) GN=clpX PE=3 SV=1 119 236 2.0E-34
sp|B8I8F6|CLPX_CLOCE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=clpX PE=3 SV=1 120 236 2.0E-34
sp|Q2SK35|CLPX_HAHCH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Hahella chejuensis (strain KCTC 2396) GN=clpX PE=3 SV=1 120 236 2.0E-34
sp|B0U5N2|CLPX_XYLFM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain M12) GN=clpX PE=3 SV=1 98 236 2.0E-34
sp|B2FQR3|CLPX_STRMK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Stenotrophomonas maltophilia (strain K279a) GN=clpX PE=3 SV=1 116 236 2.0E-34
sp|Q83G50|CLPX_TROWT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tropheryma whipplei (strain Twist) GN=clpX PE=3 SV=1 122 253 2.0E-34
sp|Q2GFT9|CLPX_EHRCR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=clpX PE=3 SV=1 117 232 2.0E-34
sp|B5EQ29|CLPX_ACIF5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=clpX PE=3 SV=1 116 242 2.0E-34
sp|B7J791|CLPX_ACIF2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=clpX PE=3 SV=1 116 242 2.0E-34
sp|A9ISA8|CLPX_BART1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=clpX PE=3 SV=1 119 236 2.0E-34
sp|Q6FEP7|CLPX_ACIAD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=clpX PE=3 SV=1 124 236 3.0E-34
sp|A8EZR2|CLPX_RICCK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia canadensis (strain McKiel) GN=clpX PE=3 SV=1 122 236 3.0E-34
sp|Q0VQ89|CLPX_ALCBS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=clpX PE=3 SV=1 123 236 3.0E-34
sp|Q6LNW1|CLPX_PHOPR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Photobacterium profundum GN=clpX PE=3 SV=1 124 236 3.0E-34
sp|B9JVD6|CLPX_AGRVS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|A1BE59|CLPX_CHLPD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium phaeobacteroides (strain DSM 266) GN=clpX PE=3 SV=1 123 242 3.0E-34
sp|Q07ZX9|CLPX_SHEFN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella frigidimarina (strain NCIMB 400) GN=clpX PE=3 SV=1 124 242 3.0E-34
sp|A1W5B7|CLPX_ACISJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax sp. (strain JS42) GN=clpX PE=3 SV=1 116 236 3.0E-34
sp|B9MG15|CLPX_ACIET ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax ebreus (strain TPSY) GN=clpX PE=3 SV=1 116 236 3.0E-34
sp|Q87E50|CLPX_XYLFT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=clpX PE=3 SV=1 98 236 3.0E-34
sp|B2I8K4|CLPX_XYLF2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain M23) GN=clpX PE=3 SV=1 98 236 3.0E-34
sp|Q6G3Z2|CLPX_BARHE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|Q6G177|CLPX_BARQU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella quintana (strain Toulouse) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|Q1MIM6|CLPX_RHIL3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|O67356|CLPX_AQUAE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aquifex aeolicus (strain VF5) GN=clpX PE=3 SV=1 124 236 3.0E-34
sp|A9M5C1|CLPX_BRUC2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|B5ZY09|CLPX_RHILW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|Q2K9U6|CLPX_RHIEC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|B3PVY5|CLPX_RHIE6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rhizobium etli (strain CIAT 652) GN=clpX PE=3 SV=1 119 236 3.0E-34
sp|Q256C3|CLPX_CHLFF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila felis (strain Fe/C-56) GN=clpX PE=3 SV=1 123 242 4.0E-34
sp|Q9PE40|CLPX_XYLFA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Xylella fastidiosa (strain 9a5c) GN=clpX PE=3 SV=1 98 236 4.0E-34
sp|Q8G0I5|CLPX_BRUSU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella suis biovar 1 (strain 1330) GN=clpX PE=3 SV=1 119 236 4.0E-34
sp|B0CGR0|CLPX_BRUSI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=clpX PE=3 SV=1 119 236 4.0E-34
sp|B0V4T7|CLPX_ACIBY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AYE) GN=clpX PE=3 SV=1 124 236 4.0E-34
sp|A3M1Y8|CLPX_ACIBT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=clpX PE=3 SV=2 124 236 4.0E-34
sp|B0VKU4|CLPX_ACIBS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain SDF) GN=clpX PE=3 SV=1 124 236 4.0E-34
sp|B2I3C2|CLPX_ACIBC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain ACICU) GN=clpX PE=3 SV=1 124 236 4.0E-34
sp|B7I5E4|CLPX_ACIB5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB0057) GN=clpX PE=3 SV=1 124 236 4.0E-34
sp|B7H092|CLPX_ACIB3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acinetobacter baumannii (strain AB307-0294) GN=clpX PE=3 SV=1 124 236 4.0E-34
sp|Q8YHC7|CLPX_BRUME ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=clpX PE=3 SV=1 119 236 4.0E-34
sp|C0RJ80|CLPX_BRUMB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=clpX PE=3 SV=1 119 236 4.0E-34
sp|Q9L7X5|CLPX_BRUAB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus biovar 1 (strain 9-941) GN=clpX PE=3 SV=2 119 236 4.0E-34
sp|Q2YPX2|CLPX_BRUA2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella abortus (strain 2308) GN=clpX PE=3 SV=1 119 236 4.0E-34
sp|B2TPB8|CLPX_CLOBB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=clpX PE=3 SV=1 122 236 4.0E-34
sp|A5VQN3|CLPX_BRUO2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=clpX PE=3 SV=1 119 236 4.0E-34
sp|A4SM43|CLPX_AERS4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aeromonas salmonicida (strain A449) GN=clpX PE=3 SV=1 119 242 4.0E-34
sp|B2UX12|CLPX_CLOBA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=clpX PE=3 SV=1 122 236 4.0E-34
sp|Q97FT7|CLPX_CLOAB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=clpX PE=3 SV=1 114 236 4.0E-34
sp|A2BZ43|CLPX_PROM5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain MIT 9515) GN=clpX PE=3 SV=1 14 232 4.0E-34
sp|Q3YSQ2|CLPX_EHRCJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia canis (strain Jake) GN=clpX PE=3 SV=1 122 232 4.0E-34
sp|A1USA8|CLPX_BARBK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=clpX PE=3 SV=1 119 236 4.0E-34
sp|Q8F353|CLPX_LEPIN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=clpX PE=3 SV=1 120 232 5.0E-34
sp|Q72SG5|CLPX_LEPIC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=clpX PE=3 SV=1 120 232 5.0E-34
sp|B8FA63|CLPX_DESAA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfatibacillum alkenivorans (strain AK-01) GN=clpX PE=3 SV=1 124 242 5.0E-34
sp|Q12LA2|CLPX_SHEDO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=clpX PE=3 SV=1 124 242 5.0E-34
sp|A8MIS7|CLPX_ALKOO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkaliphilus oremlandii (strain OhILAs) GN=clpX PE=3 SV=1 120 236 5.0E-34
sp|A0KJU2|CLPX_AERHH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=clpX PE=3 SV=1 119 242 5.0E-34
sp|P9WPB8|CLPX_MYCTO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=clpX PE=3 SV=1 119 242 5.0E-34
sp|B9DNC0|CLPX_STACT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus carnosus (strain TM300) GN=clpX PE=3 SV=1 120 236 5.0E-34
sp|A1RL88|CLPX_SHESW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain W3-18-1) GN=clpX PE=3 SV=1 124 242 5.0E-34
sp|A4Y5I3|CLPX_SHEPC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=clpX PE=3 SV=1 124 242 5.0E-34
sp|Q5L4W6|CLPX_CHLAB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=clpX PE=3 SV=1 123 242 5.0E-34
sp|Q0HTK8|CLPX_SHESR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain MR-7) GN=clpX PE=3 SV=1 124 242 5.0E-34
sp|Q0HHA2|CLPX_SHESM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain MR-4) GN=clpX PE=3 SV=1 124 242 5.0E-34
sp|A0KYL8|CLPX_SHESA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sp. (strain ANA-3) GN=clpX PE=3 SV=1 124 242 5.0E-34
sp|B1XN45|CLPX_SYNP2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=clpX PE=3 SV=1 14 242 5.0E-34
sp|Q5HBX4|CLPX_EHRRW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia ruminantium (strain Welgevonden) GN=clpX PE=3 SV=1 122 232 6.0E-34
sp|Q5FFG6|CLPX_EHRRG ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ehrlichia ruminantium (strain Gardel) GN=clpX PE=3 SV=1 122 232 6.0E-34
sp|Q180E8|CLPX_PEPD6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Peptoclostridium difficile (strain 630) GN=clpX PE=3 SV=1 118 232 6.0E-34
sp|Q5SKM7|CLPX_THET8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=clpX PE=3 SV=1 125 242 6.0E-34
sp|Q472D2|CLPX_CUPPJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=clpX PE=3 SV=1 120 242 6.0E-34
sp|Q8UFY5|CLPX_AGRFC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=clpX PE=3 SV=1 119 236 6.0E-34
sp|Q8EG18|CLPX_SHEON ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella oneidensis (strain MR-1) GN=clpX PE=3 SV=1 124 242 6.0E-34
sp|Q1LM63|CLPX_CUPMC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=clpX PE=3 SV=1 120 236 6.0E-34
sp|Q317Y5|CLPX_PROM9 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain MIT 9312) GN=clpX PE=3 SV=1 14 232 6.0E-34
sp|B3R4W2|CLPX_CUPTR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=clpX PE=3 SV=1 120 242 6.0E-34
sp|Q0KBK3|CLPX_CUPNH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=clpX PE=3 SV=1 120 242 6.0E-34
sp|Q67SJ9|CLPX_SYMTH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=clpX PE=3 SV=1 119 236 6.0E-34
sp|Q3K9X0|CLPX_PSEPF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas fluorescens (strain Pf0-1) GN=clpX PE=3 SV=1 120 236 6.0E-34
sp|A6VW21|CLPX_MARMS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Marinomonas sp. (strain MWYL1) GN=clpX PE=3 SV=1 122 236 7.0E-34
sp|Q8XKK2|CLPX_CLOPE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain 13 / Type A) GN=clpX PE=3 SV=1 124 236 7.0E-34
sp|Q0TQK3|CLPX_CLOP1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=clpX PE=3 SV=1 124 236 7.0E-34
sp|Q0ST54|CLPX_CLOPS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium perfringens (strain SM101 / Type A) GN=clpX PE=3 SV=1 124 236 7.0E-34
sp|Q72L14|CLPX_THET2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=clpX PE=3 SV=1 125 242 7.0E-34
sp|A8GPK1|CLPX_RICAH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia akari (strain Hartford) GN=clpX PE=3 SV=1 124 236 7.0E-34
sp|Q21KA8|CLPX_SACD2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=clpX PE=3 SV=1 124 236 7.0E-34
sp|B1J693|CLPX_PSEPW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain W619) GN=clpX PE=3 SV=1 120 242 8.0E-34
sp|B0KJG7|CLPX_PSEPG ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain GB-1) GN=clpX PE=3 SV=1 120 242 8.0E-34
sp|A9KWH8|CLPX_SHEB9 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS195) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|A3D306|CLPX_SHEB5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|B8E5E8|CLPX_SHEB2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS223) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|Q7UZK6|CLPX_PROMP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=clpX PE=3 SV=1 14 232 8.0E-34
sp|A5W634|CLPX_PSEP1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=clpX PE=3 SV=1 120 236 8.0E-34
sp|Q3A3X6|CLPX_PELCD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|B8CY73|CLPX_HALOH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=clpX PE=3 SV=1 120 236 8.0E-34
sp|A6T5I1|CLPX_KLEP7 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|B5Y0U1|CLPX_KLEP3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Klebsiella pneumoniae (strain 342) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|A8G7G2|CLPX_PROM2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain MIT 9215) GN=clpX PE=3 SV=1 14 232 8.0E-34
sp|C4LDB4|CLPX_TOLAT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=clpX PE=3 SV=1 119 249 8.0E-34
sp|A6WLQ2|CLPX_SHEB8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella baltica (strain OS185) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|B7LME1|CLPX_ESCF3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|Q2GD18|CLPX_NEOSM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Neorickettsia sennetsu (strain Miyayama) GN=clpX PE=3 SV=1 124 236 8.0E-34
sp|C5BTX7|CLPX_TERTT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=clpX PE=3 SV=1 123 236 8.0E-34
sp|B3PHK5|CLPX_CELJU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cellvibrio japonicus (strain Ueda107) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|Q325G3|CLPX_SHIBS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella boydii serotype 4 (strain Sb227) GN=clpX PE=3 SV=1 124 242 8.0E-34
sp|Q3Z4W5|CLPX_SHISS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella sonnei (strain Ss046) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|P0A6H4|CLPX_SHIFL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella flexneri GN=clpX PE=3 SV=2 124 242 9.0E-34
sp|Q0T7E5|CLPX_SHIF8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella flexneri serotype 5b (strain 8401) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|Q32JJ4|CLPX_SHIDS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B2U4P3|CLPX_SHIB3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|Q1RF97|CLPX_ECOUT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain UTI89 / UPEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B1LJJ5|CLPX_ECOSM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B6HZP5|CLPX_ECOSE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain SE11) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B7N8Z2|CLPX_ECOLU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|P0A6H1|CLPX_ECOLI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12) GN=clpX PE=1 SV=2 124 242 9.0E-34
sp|B1J010|CLPX_ECOLC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|P0A6H2|CLPX_ECOL6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=clpX PE=3 SV=2 124 242 9.0E-34
sp|Q0TKK3|CLPX_ECOL5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|A1A8A7|CLPX_ECOK1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O1:K1 / APEC GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|A7ZX96|CLPX_ECOHS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O9:H4 (strain HS) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B1XFM6|CLPX_ECODH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12 / DH10B) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|C4ZTJ5|CLPX_ECOBW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B7M3T1|CLPX_ECO8A ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O8 (strain IAI1) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B7MQF4|CLPX_ECO81 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O81 (strain ED1a) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B7NJ56|CLPX_ECO7I ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B5Z3U5|CLPX_ECO5E ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|P0A6H3|CLPX_ECO57 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O157:H7 GN=clpX PE=3 SV=2 124 242 9.0E-34
sp|B7L675|CLPX_ECO55 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli (strain 55989 / EAEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B7MD97|CLPX_ECO45 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B7UJR1|CLPX_ECO27 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|A7ZIJ6|CLPX_ECO24 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|Q2GJB5|CLPX_ANAPZ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anaplasma phagocytophilum (strain HZ) GN=clpX PE=3 SV=1 122 232 9.0E-34
sp|C3JYJ9|CLPX_PSEFS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas fluorescens (strain SBW25) GN=clpX PE=3 SV=1 120 242 9.0E-34
sp|Q88KI9|CLPX_PSEPK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas putida (strain KT2440) GN=clpX PE=3 SV=1 120 242 9.0E-34
sp|Q8ZRC0|CLPX_SALTY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B4TMC7|CLPX_SALSV ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella schwarzengrund (strain CVM19633) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B5BD82|CLPX_SALPK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi A (strain AKU_12601) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|C0Q7X4|CLPX_SALPC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi C (strain RKS4594) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|A9MWX5|CLPX_SALPB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|Q5PFN5|CLPX_SALPA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B4SWU2|CLPX_SALNS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella newport (strain SL254) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B4T9E4|CLPX_SALHS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella heidelberg (strain SL476) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B5R6V0|CLPX_SALG2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B5FKV4|CLPX_SALDC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella dublin (strain CT_02021853) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|Q57SB4|CLPX_SALCH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella choleraesuis (strain SC-B67) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|B5EXI9|CLPX_SALA4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella agona (strain SL483) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|A4XTZ6|CLPX_PSEMY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas mendocina (strain ymp) GN=clpX PE=3 SV=1 120 236 9.0E-34
sp|A7MFI7|CLPX_CROS8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|Q63V40|CLPX_BURPS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain K96243) GN=clpX PE=3 SV=2 120 236 9.0E-34
sp|A3NAI4|CLPX_BURP6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain 668) GN=clpX PE=3 SV=1 120 236 9.0E-34
sp|A3NWA5|CLPX_BURP0 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia pseudomallei (strain 1106a) GN=clpX PE=3 SV=1 120 236 9.0E-34
sp|B5QTJ7|CLPX_SALEP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella enteritidis PT4 (strain P125109) GN=clpX PE=3 SV=1 124 242 9.0E-34
sp|A8AK15|CLPX_CITK8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|A8F2I3|CLPX_RICM5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia massiliae (strain Mtu5) GN=clpX PE=3 SV=1 124 236 1.0E-33
sp|Q4UMY8|CLPX_RICFE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=clpX PE=3 SV=1 124 236 1.0E-33
sp|A2SFB6|CLPX_METPP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Methylibium petroleiphilum (strain PM1) GN=clpX PE=3 SV=1 120 242 1.0E-33
sp|C5CJT5|CLPX_VARPS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Variovorax paradoxus (strain S110) GN=clpX PE=3 SV=1 119 236 1.0E-33
sp|Q820F8|CLPX_STRAW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=clpX PE=3 SV=1 119 242 1.0E-33
sp|Q052U5|CLPX_LEPBL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=clpX PE=3 SV=1 120 232 1.0E-33
sp|Q04TR3|CLPX_LEPBJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=clpX PE=3 SV=1 120 232 1.0E-33
sp|A6LT28|CLPX_CLOB8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=clpX PE=3 SV=1 124 236 1.0E-33
sp|A4W7A9|CLPX_ENT38 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Enterobacter sp. (strain 638) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|Q8NW72|CLPX_STAAW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MW2) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q6G8Q1|CLPX_STAAS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MSSA476) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A1S4X6|CLPX_SHEAM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|A9MM22|CLPX_SALAR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|Q15R47|CLPX_PSEA6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=clpX PE=3 SV=1 124 236 1.0E-33
sp|Q7N0L4|CLPX_PHOLL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|Q8RC24|CLPX_CALS4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=clpX PE=3 SV=1 120 232 1.0E-33
sp|A4JF04|CLPX_BURVG ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A8Z2J5|CLPX_STAAT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|P63790|CLPX_STAAN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain N315) GN=clpX PE=1 SV=1 120 236 1.0E-33
sp|P63789|CLPX_STAAM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A6QHK8|CLPX_STAAE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Newman) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q5HF98|CLPX_STAAC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain COL) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A5ITJ9|CLPX_STAA9 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain JH9) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q2FXQ7|CLPX_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain NCTC 8325) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q2FG62|CLPX_STAA3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain USA300) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A6U2E2|CLPX_STAA2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain JH1) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A7X396|CLPX_STAA1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q87YR7|CLPX_PSESM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|C5D5L4|CLPX_GEOSW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus sp. (strain WCH70) GN=clpX PE=3 SV=1 119 242 1.0E-33
sp|Q3JAJ9|CLPX_NITOC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A4SDM4|CLPX_CHLPM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|B9DU73|CLPX_STRU0 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=clpX PE=3 SV=1 123 236 1.0E-33
sp|A9AJR1|CLPX_BURM1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q5PBC9|CLPX_ANAMM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anaplasma marginale (strain St. Maries) GN=clpX PE=3 SV=1 122 232 1.0E-33
sp|B9KHZ5|CLPX_ANAMF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anaplasma marginale (strain Florida) GN=clpX PE=3 SV=1 122 232 1.0E-33
sp|B1KLT6|CLPX_SHEWM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=clpX PE=3 SV=1 124 236 1.0E-33
sp|Q2SWQ5|CLPX_BURTA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q5KWJ9|CLPX_GEOKA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus kaustophilus (strain HTA426) GN=clpX PE=3 SV=1 119 242 1.0E-33
sp|Q6GG31|CLPX_STAAR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain MRSA252) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q2YTB5|CLPX_STAAB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|B1JHS0|CLPX_YERPY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|A4TPE2|CLPX_YERPP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis (strain Pestoides F) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|Q1CL64|CLPX_YERPN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|A9QZQ2|CLPX_YERPG ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Angola) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|Q8ZC66|CLPX_YERPE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|B2K6V8|CLPX_YERPB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|Q1C4K9|CLPX_YERPA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|A7FLC3|CLPX_YERP3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|A3QFX5|CLPX_SHELP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|A1WUM6|CLPX_HALHL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|Q39FE9|CLPX_BURL3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q0BEF7|CLPX_BURCM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|B4EBM2|CLPX_BURCJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|A0K846|CLPX_BURCH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain HI2424) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|B1JTU9|CLPX_BURCC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain MC0-3) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q1BH84|CLPX_BURCA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia cenocepacia (strain AU 1054) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|B1YRZ4|CLPX_BURA4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia ambifaria (strain MC40-6) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q4ZVM6|CLPX_PSEU2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas syringae pv. syringae (strain B728a) GN=clpX PE=3 SV=1 120 236 1.0E-33
sp|Q2NV78|CLPX_SODGM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Sodalis glossinidius (strain morsitans) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|B2UFQ3|CLPX_RALPJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ralstonia pickettii (strain 12J) GN=clpX PE=3 SV=1 119 242 1.0E-33
sp|Q5E6Q4|CLPX_VIBF1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=clpX PE=3 SV=1 124 236 1.0E-33
sp|B8CRF6|CLPX_SHEPW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=clpX PE=3 SV=1 124 242 1.0E-33
sp|B5FBZ9|CLPX_VIBFM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Vibrio fischeri (strain MJ11) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|B3QWK0|CLPX_CHLT3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|B7JW74|CLPX_CYAP8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Cyanothece sp. (strain PCC 8801) GN=clpX PE=3 SV=1 115 242 2.0E-33
sp|B0UW19|CLPX_HISS2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Histophilus somni (strain 2336) GN=clpX PE=3 SV=1 122 236 2.0E-33
sp|A8FTI0|CLPX_SHESH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella sediminis (strain HAW-EB3) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|B2JGL6|CLPX_BURP8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=clpX PE=3 SV=1 120 236 2.0E-33
sp|Q0I4F0|CLPX_HAES1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Haemophilus somnus (strain 129Pt) GN=clpX PE=3 SV=1 122 236 2.0E-33
sp|Q65RF7|CLPX_MANSM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Mannheimia succiniciproducens (strain MBEL55E) GN=clpX PE=3 SV=1 122 242 2.0E-33
sp|B0TLU8|CLPX_SHEHH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella halifaxensis (strain HAW-EB4) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|Q66DT3|CLPX_YERPS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|B7GH25|CLPX_ANOFW ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=clpX PE=3 SV=1 119 236 2.0E-33
sp|A8H613|CLPX_SHEPA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=clpX PE=3 SV=1 124 249 2.0E-33
sp|Q821L9|CLPX_CHLCV ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila caviae (strain GPIC) GN=clpX PE=3 SV=1 123 242 2.0E-33
sp|A4IRH2|CLPX_GEOTN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Geobacillus thermodenitrificans (strain NG80-2) GN=clpX PE=3 SV=1 119 242 2.0E-33
sp|Q13Z14|CLPX_BURXL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia xenovorans (strain LB400) GN=clpX PE=3 SV=1 120 236 2.0E-33
sp|Q8XYP6|CLPX_RALSO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Ralstonia solanacearum (strain GMI1000) GN=clpX PE=3 SV=1 119 242 2.0E-33
sp|B0TFI7|CLPX_HELMI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=clpX PE=3 SV=1 119 236 2.0E-33
sp|B2T404|CLPX_BURPP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=clpX PE=3 SV=1 120 236 2.0E-33
sp|Q73M37|CLPX_TREDE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|Q9CGE6|CLPX_LACLA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|Q8DZ10|CLPX_STRA5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=clpX PE=3 SV=1 119 236 2.0E-33
sp|Q0RPH1|CLPX_FRAAA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia alni (strain ACN14a) GN=clpX PE=3 SV=1 123 236 2.0E-33
sp|Q8E4L8|CLPX_STRA3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype III (strain NEM316) GN=clpX PE=3 SV=1 119 236 2.0E-33
sp|Q3K0K0|CLPX_STRA1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=clpX PE=3 SV=1 119 236 2.0E-33
sp|Q8DLI1|CLPX_THEEB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermosynechococcus elongatus (strain BP-1) GN=clpX PE=3 SV=1 123 242 2.0E-33
sp|Q9Z760|CLPX_CHLPN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia pneumoniae GN=clpX PE=3 SV=1 123 242 2.0E-33
sp|C6DB56|CLPX_PECCP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|C0ZAG3|CLPX_BREBN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=clpX PE=3 SV=1 119 236 2.0E-33
sp|A6SY75|CLPX_JANMA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Janthinobacterium sp. (strain Marseille) GN=clpX PE=3 SV=1 120 242 2.0E-33
sp|B8GNT9|CLPX_THISH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=clpX PE=3 SV=1 123 236 2.0E-33
sp|Q9K8F4|CLPX_BACHD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=clpX PE=3 SV=1 119 242 2.0E-33
sp|Q5FUR4|CLPX_GLUOX ATP-dependent Clp protease ATP-binding subunit ClpX OS=Gluconobacter oxydans (strain 621H) GN=clpX PE=3 SV=1 119 236 2.0E-33
sp|Q6D826|CLPX_PECAS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|O33873|CLPX_YEREN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia enterocolitica GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|A1JNN1|CLPX_YERE8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|P0DA37|CLPX_STRPQ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|Q48U22|CLPX_STRPM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|Q1J741|CLPX_STRPF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|Q1JHC2|CLPX_STRPD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|P63795|CLPX_STRP8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|P0DA36|CLPX_STRP3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|P63793|CLPX_STRP1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M1 GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|B3CQC6|CLPX_ORITI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Orientia tsutsugamushi (strain Ikeda) GN=clpX PE=3 SV=1 126 249 2.0E-33
sp|Q7MAS4|CLPX1_WOLSU ATP-dependent Clp protease ATP-binding subunit ClpX 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=clpX1 PE=3 SV=1 126 242 2.0E-33
sp|A8GAR0|CLPX_SERP5 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Serratia proteamaculans (strain 568) GN=clpX PE=3 SV=1 124 242 2.0E-33
sp|Q48KY9|CLPX_PSE14 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=clpX PE=3 SV=1 120 236 2.0E-33
sp|Q2JDQ7|CLPX_FRASC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia sp. (strain CcI3) GN=clpX PE=3 SV=1 123 236 2.0E-33
sp|Q8GJP6|CLPX_LACLM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|A8L1X0|CLPX_FRASN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Frankia sp. (strain EAN1pec) GN=clpX PE=3 SV=1 123 242 2.0E-33
sp|Q5XCM0|CLPX_STRP6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|A4G5X0|CLPX_HERAR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Herminiimonas arsenicoxydans GN=clpX PE=3 SV=1 120 236 2.0E-33
sp|Q9I2U0|CLPX_PSEAE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=clpX PE=3 SV=1 120 242 2.0E-33
sp|Q02KU5|CLPX_PSEAB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=clpX PE=3 SV=1 120 242 2.0E-33
sp|B7VB75|CLPX_PSEA8 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain LESB58) GN=clpX PE=3 SV=1 120 242 2.0E-33
sp|A6V718|CLPX_PSEA7 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pseudomonas aeruginosa (strain PA7) GN=clpX PE=3 SV=1 120 242 2.0E-33
sp|Q9PLM1|CLPX_CHLMU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpX PE=3 SV=1 123 242 2.0E-33
sp|B5XL03|CLPX_STRPZ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|A2RF17|CLPX_STRPG ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|Q1JM77|CLPX_STRPC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|Q1JC93|CLPX_STRPB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|A1TM61|CLPX_ACIAC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Acidovorax citrulli (strain AAC00-1) GN=clpX PE=3 SV=1 116 236 2.0E-33
sp|B4U360|CLPX_STREM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=clpX PE=3 SV=1 124 236 2.0E-33
sp|A1VE84|CLPX_DESVV ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=clpX PE=3 SV=1 122 242 2.0E-33
sp|Q72CE7|CLPX_DESVH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=clpX PE=3 SV=1 122 242 2.0E-33
sp|Q8D347|CLPX_WIGBR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Wigglesworthia glossinidia brevipalpis GN=clpX PE=3 SV=1 124 249 3.0E-33
sp|A5CDP2|CLPX_ORITB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Orientia tsutsugamushi (strain Boryong) GN=clpX PE=3 SV=1 126 249 3.0E-33
sp|A6TM62|CLPX_ALKMQ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Alkaliphilus metalliredigens (strain QYMF) GN=clpX PE=3 SV=1 119 236 3.0E-33
sp|Q68W45|CLPX_RICTY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|Q8Z8V1|CLPX_SALTI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salmonella typhi GN=clpX PE=3 SV=1 124 242 3.0E-33
sp|Q3B5I8|CLPX_CHLL7 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=clpX PE=3 SV=1 123 242 3.0E-33
sp|Q2RL30|CLPX_MOOTA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Moorella thermoacetica (strain ATCC 39073) GN=clpX PE=3 SV=1 120 236 3.0E-33
sp|B1VXA8|CLPX_STRGG ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=clpX PE=3 SV=1 124 242 3.0E-33
sp|Q4L715|CLPX_STAHJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus haemolyticus (strain JCSC1435) GN=clpX PE=3 SV=1 123 236 3.0E-33
sp|Q92C84|CLPX_LISIN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=clpX PE=3 SV=1 119 242 3.0E-33
sp|Q5WEN9|CLPX_BACSK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus clausii (strain KSM-K16) GN=clpX PE=3 SV=1 98 236 3.0E-33
sp|C4K2L5|CLPX_RICPU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia peacockii (strain Rustic) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|A0AI71|CLPX_LISW6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=clpX PE=3 SV=1 119 242 3.0E-33
sp|C0MEW5|CLPX_STRS7 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|C0M9R7|CLPX_STRE4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus equi subsp. equi (strain 4047) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|Q8Y7K9|CLPX_LISMO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=clpX PE=3 SV=1 119 236 3.0E-33
sp|B8DHN7|CLPX_LISMH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=clpX PE=3 SV=1 119 236 3.0E-33
sp|Q720F3|CLPX_LISMF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4b (strain F2365) GN=clpX PE=3 SV=1 119 236 3.0E-33
sp|C1L2H6|CLPX_LISMC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=clpX PE=3 SV=1 119 236 3.0E-33
sp|O84711|CLPX_CHLTR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=clpX PE=3 SV=1 123 242 3.0E-33
sp|B0BAG0|CLPX_CHLTB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=clpX PE=3 SV=1 123 242 3.0E-33
sp|B0B8T1|CLPX_CHLT2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=clpX PE=3 SV=1 123 242 3.0E-33
sp|B1HVE5|CLPX_LYSSC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lysinibacillus sphaericus (strain C3-41) GN=clpX PE=3 SV=1 119 236 3.0E-33
sp|A8GTC4|CLPX_RICRS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia rickettsii (strain Sheila Smith) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|B0BUW3|CLPX_RICRO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia rickettsii (strain Iowa) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|A4XAH9|CLPX_SALTO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=clpX PE=3 SV=1 116 242 3.0E-33
sp|P57981|CLPX_PASMU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Pasteurella multocida (strain Pm70) GN=clpX PE=3 SV=1 122 242 3.0E-33
sp|Q9WXZ3|CLPX_THEMA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=clpX PE=3 SV=1 124 232 3.0E-33
sp|Q8CNY5|CLPX_STAES ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus epidermidis (strain ATCC 12228) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|Q5HNM9|CLPX_STAEQ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|Q92GQ4|CLPX_RICCN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|C3PLG9|CLPX_RICAE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia africae (strain ESF-5) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|P50866|CLPX_BACSU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus subtilis (strain 168) GN=clpX PE=2 SV=3 119 236 3.0E-33
sp|Q47XL9|CLPX_COLP3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|A0Q2L0|CLPX_CLONN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium novyi (strain NT) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|Q82Y56|CLPX_NITEU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=clpX PE=3 SV=1 124 236 3.0E-33
sp|A7GTF1|CLPX_BACCN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=clpX PE=3 SV=1 119 236 3.0E-33
sp|Q5N1P7|CLPX_SYNP6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=clpX PE=3 SV=1 124 242 3.0E-33
sp|O34126|CLPX_SYNE7 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus elongatus (strain PCC 7942) GN=clpX PE=3 SV=2 124 242 3.0E-33
sp|Q6AK60|CLPX_DESPS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=clpX PE=3 SV=1 124 242 4.0E-33
sp|C3PI25|CLPX_CORA7 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|Q6HD54|CLPX_BACHK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|Q633X2|CLPX_BACCZ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain ZK / E33L) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|B9IZ47|CLPX_BACCQ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain Q1) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|B7HQN2|CLPX_BACC7 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain AH187) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|C1ETR8|CLPX_BACC3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain 03BB102) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|Q72ZV4|CLPX_BACC1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|B7JQ65|CLPX_BACC0 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain AH820) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|Q81LB9|CLPX_BACAN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus anthracis GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|C3L704|CLPX_BACAC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|C3P9F7|CLPX_BACAA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus anthracis (strain A0248) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|Q1MQ78|CLPX_LAWIP ATP-dependent Clp protease ATP-binding subunit ClpX OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=clpX PE=3 SV=1 112 242 4.0E-33
sp|Q9F316|CLPX_STRCO ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=clpX PE=3 SV=1 124 242 4.0E-33
sp|Q817Q2|CLPX_BACCR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|B7HEA4|CLPX_BACC4 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain B4264) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|B7IIY3|CLPX_BACC2 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus cereus (strain G9842) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|Q9ZCN1|CLPX_RICPR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Rickettsia prowazekii (strain Madrid E) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|A7GIH1|CLPX_CLOBL ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|B1IND6|CLPX_CLOBK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Okra / Type B1) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|C1FLA5|CLPX_CLOBJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Kyoto / Type A2) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|A5I6W0|CLPX_CLOBH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|C3KU76|CLPX_CLOB6 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain 657 / Type Ba4) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|A7FYI1|CLPX_CLOB1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|A2BTN8|CLPX_PROMS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Prochlorococcus marinus (strain AS9601) GN=clpX PE=3 SV=1 14 232 4.0E-33
sp|Q891J8|CLPX_CLOTE ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium tetani (strain Massachusetts / E88) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|A7Z7B2|CLPX_BACMF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=clpX PE=3 SV=1 119 236 4.0E-33
sp|A3DJ11|CLPX_CLOTH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=clpX PE=3 SV=1 120 236 4.0E-33
sp|B1L1D6|CLPX_CLOBM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|Q3KKY9|CLPX_CHLTA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=clpX PE=3 SV=1 128 242 4.0E-33
sp|Q49YA6|CLPX_STAS1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=clpX PE=3 SV=1 123 236 4.0E-33
sp|Q9X5N1|CLPX_MYXXA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Myxococcus xanthus GN=clpX PE=3 SV=1 124 242 4.0E-33
sp|A9C1U9|CLPX_DELAS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=clpX PE=3 SV=1 116 242 4.0E-33
sp|Q833M7|CLPX_ENTFA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=clpX PE=3 SV=1 124 236 4.0E-33
sp|Q2JLU2|CLPX_SYNJB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=clpX PE=3 SV=1 119 242 4.0E-33
sp|Q3M727|CLPX_ANAVT ATP-dependent Clp protease ATP-binding subunit ClpX OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=clpX PE=3 SV=1 124 242 4.0E-33
sp|Q2Y6J1|CLPX_NITMU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=clpX PE=3 SV=1 119 242 5.0E-33
sp|P0CAU2|CLPX_CAUCR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=clpX PE=1 SV=1 119 242 5.0E-33
sp|B8GX14|CLPX_CAUCN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=clpX PE=3 SV=1 119 242 5.0E-33
sp|C0QHJ8|CLPX_DESAH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=clpX PE=3 SV=1 124 242 5.0E-33
sp|A8AXB9|CLPX_STRGC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=clpX PE=3 SV=1 117 236 5.0E-33
sp|B2S3A2|CLPX_TREPS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema pallidum subsp. pallidum (strain SS14) GN=clpX PE=3 SV=1 124 236 5.0E-33
sp|O83521|CLPX_TREPA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Treponema pallidum (strain Nichols) GN=clpX PE=3 SV=1 124 236 5.0E-33
sp|Q11J59|CLPX_CHESB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chelativorans sp. (strain BNC1) GN=clpX PE=3 SV=1 120 236 5.0E-33
sp|A8M1K7|CLPX_SALAI ATP-dependent Clp protease ATP-binding subunit ClpX OS=Salinispora arenicola (strain CNS-205) GN=clpX PE=3 SV=1 124 242 5.0E-33
sp|B0SZ62|CLPX_CAUSK ATP-dependent Clp protease ATP-binding subunit ClpX OS=Caulobacter sp. (strain K31) GN=clpX PE=3 SV=1 119 242 5.0E-33
sp|Q8YQX7|CLPX_NOSS1 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=clpX PE=3 SV=1 124 242 5.0E-33
sp|Q7W8X1|CLPX_BORPA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=clpX PE=3 SV=2 120 236 5.0E-33
sp|Q7WK82|CLPX_BORBR ATP-dependent Clp protease ATP-binding subunit ClpX OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=clpX PE=3 SV=2 120 236 5.0E-33
sp|A0LDT3|CLPX_MAGMM ATP-dependent Clp protease ATP-binding subunit ClpX OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=clpX PE=3 SV=1 122 236 5.0E-33
sp|Q12BY1|CLPX_POLSJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=clpX PE=3 SV=1 119 236 5.0E-33
sp|A5GQ09|CLPX_SYNR3 ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain RCC307) GN=clpX PE=3 SV=1 122 242 5.0E-33
sp|Q2JW64|CLPX_SYNJA ATP-dependent Clp protease ATP-binding subunit ClpX OS=Synechococcus sp. (strain JA-3-3Ab) GN=clpX PE=3 SV=1 123 242 5.0E-33
sp|Q24SJ9|CLPX_DESHY ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfitobacterium hafniense (strain Y51) GN=clpX PE=3 SV=1 120 236 5.0E-33
sp|B8FVI0|CLPX_DESHD ATP-dependent Clp protease ATP-binding subunit ClpX OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=clpX PE=3 SV=1 120 236 5.0E-33
sp|Q0AJI3|CLPX_NITEC ATP-dependent Clp protease ATP-binding subunit ClpX OS=Nitrosomonas eutropha (strain C91) GN=clpX PE=3 SV=1 124 236 5.0E-33
sp|B2IR87|CLPX_STRPS ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain CGSP14) GN=clpX PE=3 SV=1 124 236 5.0E-33
sp|B8ZLT1|CLPX_STRPJ ATP-dependent Clp protease ATP-binding subunit ClpX OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=clpX PE=3 SV=1 124 236 5.0E-33
sp|Q256C3|CLPX_CHLFF ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila felis (strain Fe/C-56) GN=clpX PE=3 SV=1 14 54 1.0E-07
sp|Q5L4W6|CLPX_CHLAB ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=clpX PE=3 SV=1 14 54 2.0E-07
sp|Q821L9|CLPX_CHLCV ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydophila caviae (strain GPIC) GN=clpX PE=3 SV=1 14 54 2.0E-07
sp|Q9Z760|CLPX_CHLPN ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia pneumoniae GN=clpX PE=3 SV=1 14 54 6.0E-07
sp|Q9PLM1|CLPX_CHLMU ATP-dependent Clp protease ATP-binding subunit ClpX OS=Chlamydia muridarum (strain MoPn / Nigg) GN=clpX PE=3 SV=1 14 54 3.0E-06
sp|B8GNT9|CLPX_THISH ATP-dependent Clp protease ATP-binding subunit ClpX OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=clpX PE=3 SV=1 14 56 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0032508 DNA duplex unwinding Yes
GO:0008150 biological_process No
GO:0032555 purine ribonucleotide binding No
GO:0071103 DNA conformation change No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0032392 DNA geometric change No
GO:0016043 cellular component organization No
GO:0036094 small molecule binding No
GO:0003676 nucleic acid binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901363 heterocyclic compound binding No
GO:0016462 pyrophosphatase activity No
GO:0009987 cellular process No
GO:0006996 organelle organization No
GO:0017076 purine nucleotide binding No
GO:0071840 cellular component organization or biogenesis No
GO:0097367 carbohydrate derivative binding No
GO:0051276 chromosome organization No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Mitochondrial transit peptide|Nuclear export signal 0.2952 0.6794 0.012 0.0339 0.4842 0.0245 0.2747 0.3678 0.2515 0.0319

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup808
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2440
Ophiocordyceps australis map64 (Brazil) OphauB2|2510
Ophiocordyceps camponoti-floridani Ophcf2|03264
Ophiocordyceps camponoti-rufipedis Ophun1|7295
Ophiocordyceps kimflemingae Ophio5|8211
Ophiocordyceps subramaniannii Hirsu2|3695 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3695
MFSKASFGVPQFYPRDLKKRVDEYVVGQDRAKKTICCTLFNHYQNLRRRHQNEHEERNMQEKIMRQRLARDRELH
QLRREMHPIEDGFPDHSNSVRLQREQNNTESHSLDHLYIPEDYSKPSHVKIDKSNLLLVGPTGVGKTYILETLSK
KIQVPFSICDCNSLTQAGYIGQDVETCIERLLIEANYDVKATERGIVVLDEFDKLARRESPTGRDVGGEGVQQAL
LKLVEGTKVTINVKDSRSSRSAPQTTTNFGSSGP*
Coding >Hirsu2|3695
ATGTTCAGCAAGGCCAGCTTCGGTGTTCCTCAATTTTACCCCCGAGATCTGAAGAAGCGAGTCGACGAATACGTC
GTCGGCCAGGATCGAGCCAAGAAGACAATCTGCTGCACTTTGTTCAACCATTACCAGAACCTGCGCCGTAGACAC
CAAAATGAGCACGAGGAAAGAAACATGCAAGAGAAGATCATGCGACAGAGACTTGCACGGGACAGGGAACTGCAC
CAACTGCGCCGCGAGATGCACCCGATCGAAGATGGATTTCCGGATCACTCCAACTCTGTGCGGCTACAGCGTGAA
CAGAATAATACCGAAAGCCATTCCCTCGACCATCTATATATTCCAGAGGACTATTCGAAGCCCAGTCACGTAAAG
ATTGACAAGAGCAACCTTTTACTTGTTGGTCCAACAGGGGTCGGCAAGACCTACATACTAGAGACATTAAGCAAG
AAAATTCAGGTCCCGTTCTCAATCTGCGATTGTAACTCCCTGACCCAGGCAGGGTATATTGGACAGGACGTGGAA
ACATGCATTGAGCGTCTGTTGATAGAGGCCAATTACGATGTCAAGGCAACGGAACGTGGCATAGTAGTCTTGGAC
GAGTTCGACAAGCTAGCCCGACGAGAATCCCCGACCGGCCGCGATGTCGGCGGCGAGGGCGTCCAGCAAGCGCTT
CTGAAACTGGTCGAGGGTACCAAGGTCACCATCAATGTCAAGGACAGCCGATCATCGCGATCAGCGCCGCAAACA
ACGACCAACTTCGGCTCCTCCGGGCCTTGA
Transcript >Hirsu2|3695
ATGTTCAGCAAGGCCAGCTTCGGTGTTCCTCAATTTTACCCCCGAGATCTGAAGAAGCGAGTCGACGAATACGTC
GTCGGCCAGGATCGAGCCAAGAAGACAATCTGCTGCACTTTGTTCAACCATTACCAGAACCTGCGCCGTAGACAC
CAAAATGAGCACGAGGAAAGAAACATGCAAGAGAAGATCATGCGACAGAGACTTGCACGGGACAGGGAACTGCAC
CAACTGCGCCGCGAGATGCACCCGATCGAAGATGGATTTCCGGATCACTCCAACTCTGTGCGGCTACAGCGTGAA
CAGAATAATACCGAAAGCCATTCCCTCGACCATCTATATATTCCAGAGGACTATTCGAAGCCCAGTCACGTAAAG
ATTGACAAGAGCAACCTTTTACTTGTTGGTCCAACAGGGGTCGGCAAGACCTACATACTAGAGACATTAAGCAAG
AAAATTCAGGTCCCGTTCTCAATCTGCGATTGTAACTCCCTGACCCAGGCAGGGTATATTGGACAGGACGTGGAA
ACATGCATTGAGCGTCTGTTGATAGAGGCCAATTACGATGTCAAGGCAACGGAACGTGGCATAGTAGTCTTGGAC
GAGTTCGACAAGCTAGCCCGACGAGAATCCCCGACCGGCCGCGATGTCGGCGGCGAGGGCGTCCAGCAAGCGCTT
CTGAAACTGGTCGAGGGTACCAAGGTCACCATCAATGTCAAGGACAGCCGATCATCGCGATCAGCGCCGCAAACA
ACGACCAACTTCGGCTCCTCCGGGCCTTGA
Gene >Hirsu2|3695
ATGTTCAGCAAGGCCAGCTTCGGTGTTCCTCAATTTTACCCCCGAGATCTGAAGAAGCGAGTCGACGAATACGTC
GTCGGCCAGGATCGAGCCAAGAAGACAATCTGCTGCACTTTGTTCAACCATTACCAGAACCTGCGCCGTAGACAC
CAAAATGAGCACGAGGAAAGAAACATGCAAGAGAAGATCATGCGACAGAGACTTGCACGGGACAGGGAACTGCAC
CAACTGCGCCGCGAGATGCACCCGATCGAAGGTCAGTCAGCATCCTCCGAACATGCACAGCTCAGTGCCGCTGAT
CAAATAAATCAAGATGGATTTCCGGATCACTCCAACTCTGTGCGGCTACAGCGTGAACAGAATAATACCGAAAGC
CATTCCCTCGACCATCTATATATTCCAGAGGACTATTCGAAGCCCAGTCACGTAAAGATTGACAAGAGCAACCTT
TTACTTGTTGGTCCAACAGGGGTCGGCAAGACCTACATACTAGAGTAAGTTGACTGCCGGGTCAGTCGATCTGGA
TGTTCAGACTGAAAACGACGTAGGACATTAAGCAAGAAAATTCAGGTCCCGTTCTCAATCTGCGATTGTAACTCC
CTGACCCAGGCAGGGTATATTGGACAGGACGTGGAAACATGCATTGAGCGTCTGTTGATAGAGGCCAATTACGAT
GTCAAGGCAACGGAACGTGGCATAGTAGTCTTGGACGAGTTCGACAAGCTAGCCCGACGAGAATCCCCGACCGGC
CGCGATGTCGGCGGCGAGGGCGTCCAGCAAGCGCTTCTGAAACTGGTCGAGGGTACCAAGGTCACCATCAATGTC
AAGGACAGCCGATCATCGCGATCAGCGCCGCAAACAACGACCAACTTCGGCTCCTCCGGGCCGTCTTCCTCGTCG
CCTCAAGGTGCTCCTCCCACTGGCAAAGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail