Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3685
Gene name
LocationContig_1992:2690..3684
Strand+
Gene length (bp)994
Transcript length (bp)846
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04851 ResIII Type III restriction enzyme, res subunit 1.6E-25 46 208
PF00270 DEAD DEAD/DEAH box helicase 1.0E-11 51 211

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 47 261 2.0E-56
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 49 267 6.0E-48
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 49 176 1.0E-06
sp|Q47281|T1RE_ECOLX Type I restriction enzyme EcoEI R protein OS=Escherichia coli GN=hsdR PE=3 SV=1 50 238 3.0E-06

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3685
MMLRIAARCVFRPGPARSARLFRPLGFRAGAATLVTSPGNNIISTKLQLRDYQQECINSVLSSLKHGHKRVGISL
ATGSGKTVIFTQLIDKIPSRPCGGDRTLILAHRRELVEQAARHCRLAYPDKTIELEMGSVHASGAADITVASVQS
ITSKDRLDKYQSDAFKLVLVDEAHHIVAPGYLRTLQQFGLERKRDRSPVLVGVSATFSRFDGVKLGAAIDEIVYH
KDYVDMISDKWLSDVVFTTVKTSANLSKVRNGAFGDFQTGELRRSSSASTWPTWPA*
Coding >Hirsu2|3685
ATGATGCTACGCATCGCTGCAAGATGCGTCTTCCGTCCAGGCCCTGCCAGGAGCGCGCGGCTCTTCCGTCCGCTT
GGCTTCAGGGCCGGCGCCGCGACGCTCGTCACGTCGCCGGGCAACAACATCATCAGCACCAAGCTTCAGCTGCGC
GACTACCAGCAGGAATGCATCAACTCGGTCCTCTCGTCCCTCAAGCACGGCCACAAGCGCGTCGGCATCTCGCTG
GCCACGGGCAGCGGTAAGACGGTCATCTTCACCCAGCTCATCGACAAGATCCCCTCGCGGCCGTGCGGCGGCGAC
CGCACGCTCATCCTGGCCCACCGGCGCGAGCTGGTGGAACAGGCGGCGCGGCACTGCCGCCTCGCCTACCCGGAC
AAGACGATCGAGCTCGAGATGGGGTCGGTGCACGCGTCGGGGGCGGCCGACATCACCGTCGCCAGCGTCCAGAGC
ATCACGTCCAAGGACCGGCTGGACAAGTACCAGTCGGACGCGTTCAAGCTGGTGCTCGTCGACGAGGCCCACCAC
ATCGTCGCGCCGGGCTACCTCAGGACGCTGCAGCAGTTCGGGCTCGAGCGGAAGCGGGACCGGTCGCCCGTCCTC
GTCGGAGTCTCGGCCACCTTCTCGCGCTTCGACGGCGTCAAGCTGGGCGCGGCCATCGACGAGATCGTCTACCAC
AAGGACTACGTCGACATGATCTCGGACAAGTGGCTGTCGGACGTCGTCTTCACCACGGTCAAGACGTCGGCCAAC
CTGTCCAAGGTCCGCAACGGCGCCTTCGGCGACTTCCAGACGGGCGAGCTTCGACGCTCGTCTTCTGCGTCGACC
TGGCCCACGTGGCCGGCCTGA
Transcript >Hirsu2|3685
ATGATGCTACGCATCGCTGCAAGATGCGTCTTCCGTCCAGGCCCTGCCAGGAGCGCGCGGCTCTTCCGTCCGCTT
GGCTTCAGGGCCGGCGCCGCGACGCTCGTCACGTCGCCGGGCAACAACATCATCAGCACCAAGCTTCAGCTGCGC
GACTACCAGCAGGAATGCATCAACTCGGTCCTCTCGTCCCTCAAGCACGGCCACAAGCGCGTCGGCATCTCGCTG
GCCACGGGCAGCGGTAAGACGGTCATCTTCACCCAGCTCATCGACAAGATCCCCTCGCGGCCGTGCGGCGGCGAC
CGCACGCTCATCCTGGCCCACCGGCGCGAGCTGGTGGAACAGGCGGCGCGGCACTGCCGCCTCGCCTACCCGGAC
AAGACGATCGAGCTCGAGATGGGGTCGGTGCACGCGTCGGGGGCGGCCGACATCACCGTCGCCAGCGTCCAGAGC
ATCACGTCCAAGGACCGGCTGGACAAGTACCAGTCGGACGCGTTCAAGCTGGTGCTCGTCGACGAGGCCCACCAC
ATCGTCGCGCCGGGCTACCTCAGGACGCTGCAGCAGTTCGGGCTCGAGCGGAAGCGGGACCGGTCGCCCGTCCTC
GTCGGAGTCTCGGCCACCTTCTCGCGCTTCGACGGCGTCAAGCTGGGCGCGGCCATCGACGAGATCGTCTACCAC
AAGGACTACGTCGACATGATCTCGGACAAGTGGCTGTCGGACGTCGTCTTCACCACGGTCAAGACGTCGGCCAAC
CTGTCCAAGGTCCGCAACGGCGCCTTCGGCGACTTCCAGACGGGCGAGCTTCGACGCTCGTCTTCTGCGTCGACC
TGGCCCACGTGGCCGGCCTGA
Gene >Hirsu2|3685
ATGATGCTACGCATCGCTGCAAGATGCGTCTTCCGTCCAGGCCCTGCCAGGAGCGCGCGGCTCTTCCGTCCGCTT
GGCTTCAGGGCCGGCGCCGCGACGCTCGTCACGTCGCCGGGCAACAACATCATCAGCACCAAGCTTCAGCTGCGC
GACTACCAGCAGGAATGCATCAACTCGGTCCTCTCGTCCCTCAAGCACGGCCACAAGCGCGTCGGCATCTCGCTG
GCCACGGGCAGCGGTAAGACGGTAAGGCACTGCGCCCCGGCCGAGCGACGAGGACGACTTTGTGGCTGACGCTCG
ATCCTCTCCCGTCGCCAGGTCATCTTCACCCAGCTCATCGACAAGATCCCCTCGCGGCCGTGCGGCGGCGACCGC
ACGCTCATCCTGGCCCACCGGCGCGAGCTGGTGGAACAGGCGGCGCGGCACTGCCGCCTCGCCTACCCGGACAAG
ACGATCGAGCTCGAGATGGGGTCGGTGCACGCGTCGGGGGCGGCCGACATCACCGTCGCCAGCGTCCAGAGCATC
ACGTCCAAGGACCGGCTGGACAAGTACCAGTCGGACGCGTTCAAGCTGGTGCTCGTCGACGAGGCCCACCACATC
GTCGCGCCGGGCTACCTCAGGACGCTGCAGCAGTTCGGGCTCGAGCGGAAGCGGGACCGGTCGCCCGTCCTCGTC
GGAGTCTCGGCCACCTTCTCGCGCTTCGACGGCGTCAAGCTGGGCGCGGCCATCGACGAGATCGTCTACCACAAG
GACTACGTCGACATGATCTCGGACAAGTGGCTGTCGGACGTCGTCTTCACCACGGTCAAGACGTCGGCCAACCTG
TCCAAGGTCCGCAACGGCGCCTTCGGCGACTTCCAGACGGGCGAGCTGTCGCGCGTCGTCAACACGGACGAGGTC
AACGAGACCATCGTCCGCAGCTGGCTGGCCAAGGCCGAGGGCCGCAAGTCGACGCTCGTCTTCTGCGTCGACCTG
GCCCACGTGGCCGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail