Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3683
Gene name
LocationContig_1991:585..2263
Strand-
Gene length (bp)1678
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74839|YC1B_SCHPO Uncharacterized MscS family protein C1183.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.11 PE=1 SV=1 137 501 2.0E-61
sp|O14050|YEYH_SCHPO Uncharacterized MscS family protein C2C4.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.17c PE=3 SV=1 96 504 2.0E-39

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 139 161 22
2 171 193 22
3 222 244 22
4 264 286 22
5 484 501 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3683
MAGLAAPRSQPDGAEPRPPPLHVHQEEEFDEKHTAPSLDTFNTLATPPDTDALSPSGQRIEARRLNDDLELLRAE
RLVSNQEQEQQLGSKSKNRSHHPEPEDAFNQPSTKDPTVKLKNKDAALYKFWLLLKKFPRSVRYLLYLFPGAALL
LVPVLLGGIEFRPDDKLVGGVGGVQLMWFGIWLEVVWCSLWLSRLLTSLLPSLFYTVAHVGGSINARKWKEIGSR
LELPTALFLWFLAILVSFKPTTDGHRGRVPPGRDADVGVAWIDVVNKVIIALFTLATLNLVEKLVIQWIATSFHQ
RTYSTRIENNKADTLHLVRLYEYAKAKLEHSDSFWQRATGTTNTGAHTPLKSLHNNARHVLGKVGQVANRVGNDL
IGRKVNTNVPRKVVSELLRTTTASHSLARLIYRSLVRDGRDTVYPDDLAVVFDEQDDIDATFSVFDKDLNGDISI
DEFEAVCNEIHLEKKAIAASLKDLDSVIRKLDNVFLFIIVVIAIIVFISILPSSSSSSSTPSTSATASPSTAPPA
PT*
Coding >Hirsu2|3683
ATGGCCGGCTTGGCGGCCCCTCGTTCGCAGCCAGACGGCGCCGAGCCTCGGCCGCCGCCGCTCCACGTCCACCAG
GAGGAGGAGTTCGACGAGAAGCACACGGCGCCGTCGCTCGACACGTTCAACACGCTGGCCACGCCGCCCGACACC
GACGCCCTGTCGCCCTCGGGCCAGCGCATCGAGGCCAGGCGTCTTAACGACGACCTCGAGCTCCTCCGCGCCGAG
CGCCTCGTCTCCAACCAGGAGCAGGAGCAGCAGCTGGGCTCCAAGTCTAAGAACCGGAGCCACCACCCCGAGCCC
GAGGACGCCTTCAACCAGCCCAGCACCAAGGACCCGACCGTCAAGCTCAAGAACAAGGACGCCGCCCTCTACAAG
TTCTGGCTGCTGCTCAAAAAGTTCCCCCGCTCCGTCCGCTACCTCCTCTACCTCTTCCCCGGCGCCGCCCTGCTG
CTCGTGCCCGTCCTCCTCGGCGGCATCGAGTTCCGCCCCGACGACAAGCTCGTCGGCGGCGTCGGCGGCGTCCAG
CTCATGTGGTTCGGCATCTGGCTCGAGGTCGTCTGGTGCTCGCTCTGGCTGTCGCGCCTGCTCACAAGTCTGCTG
CCCAGCCTCTTCTACACCGTCGCCCACGTCGGCGGCTCCATCAACGCCCGTAAGTGGAAGGAGATTGGCAGCCGG
CTCGAGCTGCCCACCGCCCTCTTCCTCTGGTTCCTCGCCATCCTCGTCTCCTTCAAGCCCACCACCGACGGCCAC
CGCGGCCGCGTGCCGCCCGGCCGCGACGCCGACGTCGGCGTCGCCTGGATCGACGTCGTCAACAAGGTCATCATC
GCCCTCTTCACCCTCGCCACCCTCAACCTGGTGGAGAAGCTGGTGATCCAGTGGATCGCCACCTCCTTCCACCAG
CGCACCTACTCGACCCGCATCGAGAACAACAAGGCCGACACGCTCCACCTCGTCCGGCTGTACGAGTATGCCAAG
GCCAAGCTCGAGCACAGCGACAGCTTCTGGCAGCGCGCCACCGGCACCACCAACACCGGCGCCCACACGCCCCTC
AAGTCGCTGCACAACAACGCCCGCCACGTGCTGGGCAAGGTCGGCCAGGTGGCCAACCGCGTCGGCAACGACCTC
ATCGGCCGCAAGGTCAACACCAACGTGCCGCGCAAGGTCGTCTCCGAGCTCCTCCGCACCACGACCGCCTCGCAC
AGCCTGGCCCGCCTCATCTACCGCAGCCTCGTCCGCGACGGCCGCGACACCGTCTACCCGGACGACCTGGCCGTC
GTCTTCGACGAGCAGGACGACATCGACGCCACCTTCAGCGTCTTCGACAAGGACCTCAACGGCGACATCTCCATC
GACGAGTTCGAGGCCGTCTGCAACGAGATCCACCTGGAGAAGAAGGCCATCGCCGCCTCGCTCAAGGACCTCGAC
TCCGTCATCCGCAAGCTCGACAACGTCTTCCTCTTCATCATCGTCGTCATCGCCATCATCGTCTTCATCTCCATC
CTTCCGTCATCTTCGTCTTCATCAAGCACCCCTTCGACGTCGGCGACCGCGTCACCATCTACGGCTCCACCGGCG
CCGACATGA
Transcript >Hirsu2|3683
ATGGCCGGCTTGGCGGCCCCTCGTTCGCAGCCAGACGGCGCCGAGCCTCGGCCGCCGCCGCTCCACGTCCACCAG
GAGGAGGAGTTCGACGAGAAGCACACGGCGCCGTCGCTCGACACGTTCAACACGCTGGCCACGCCGCCCGACACC
GACGCCCTGTCGCCCTCGGGCCAGCGCATCGAGGCCAGGCGTCTTAACGACGACCTCGAGCTCCTCCGCGCCGAG
CGCCTCGTCTCCAACCAGGAGCAGGAGCAGCAGCTGGGCTCCAAGTCTAAGAACCGGAGCCACCACCCCGAGCCC
GAGGACGCCTTCAACCAGCCCAGCACCAAGGACCCGACCGTCAAGCTCAAGAACAAGGACGCCGCCCTCTACAAG
TTCTGGCTGCTGCTCAAAAAGTTCCCCCGCTCCGTCCGCTACCTCCTCTACCTCTTCCCCGGCGCCGCCCTGCTG
CTCGTGCCCGTCCTCCTCGGCGGCATCGAGTTCCGCCCCGACGACAAGCTCGTCGGCGGCGTCGGCGGCGTCCAG
CTCATGTGGTTCGGCATCTGGCTCGAGGTCGTCTGGTGCTCGCTCTGGCTGTCGCGCCTGCTCACAAGTCTGCTG
CCCAGCCTCTTCTACACCGTCGCCCACGTCGGCGGCTCCATCAACGCCCGTAAGTGGAAGGAGATTGGCAGCCGG
CTCGAGCTGCCCACCGCCCTCTTCCTCTGGTTCCTCGCCATCCTCGTCTCCTTCAAGCCCACCACCGACGGCCAC
CGCGGCCGCGTGCCGCCCGGCCGCGACGCCGACGTCGGCGTCGCCTGGATCGACGTCGTCAACAAGGTCATCATC
GCCCTCTTCACCCTCGCCACCCTCAACCTGGTGGAGAAGCTGGTGATCCAGTGGATCGCCACCTCCTTCCACCAG
CGCACCTACTCGACCCGCATCGAGAACAACAAGGCCGACACGCTCCACCTCGTCCGGCTGTACGAGTATGCCAAG
GCCAAGCTCGAGCACAGCGACAGCTTCTGGCAGCGCGCCACCGGCACCACCAACACCGGCGCCCACACGCCCCTC
AAGTCGCTGCACAACAACGCCCGCCACGTGCTGGGCAAGGTCGGCCAGGTGGCCAACCGCGTCGGCAACGACCTC
ATCGGCCGCAAGGTCAACACCAACGTGCCGCGCAAGGTCGTCTCCGAGCTCCTCCGCACCACGACCGCCTCGCAC
AGCCTGGCCCGCCTCATCTACCGCAGCCTCGTCCGCGACGGCCGCGACACCGTCTACCCGGACGACCTGGCCGTC
GTCTTCGACGAGCAGGACGACATCGACGCCACCTTCAGCGTCTTCGACAAGGACCTCAACGGCGACATCTCCATC
GACGAGTTCGAGGCCGTCTGCAACGAGATCCACCTGGAGAAGAAGGCCATCGCCGCCTCGCTCAAGGACCTCGAC
TCCGTCATCCGCAAGCTCGACAACGTCTTCCTCTTCATCATCGTCGTCATCGCCATCATCGTCTTCATCTCCATC
CTTCCGTCATCTTCGTCTTCATCAAGCACCCCTTCGACGTCGGCGACCGCGTCACCATCTACGGCTCCACCGGCG
CCGACATGA
Gene >Hirsu2|3683
ATGGCCGGCTTGGCGGCCCCTCGTTCGCAGCCAGACGGCGCCGAGCCTCGGCCGCCGCCGCTCCACGTCCACCAG
GAGGAGGAGTTCGACGAGAAGCACACGGCGCCGTCGCTCGACACGTTCAACACGCTGGCCACGCCGCCCGACACC
GACGCCCTGTCGCCCTCGGGCCAGCGCATCGAGGCCAGGCGTCTTAACGACGACCTCGAGCTCCTCCGCGCCGAG
CGCCTCGTCTCCAACCAGGAGCAGGAGCAGCAGCTGGGCTCCAAGTCTAAGAACCGGAGCCACCACCCCGAGCCC
GAGGACGCCTTCAACCAGCCCAGCACCAAGGACCCGACCGTCAAGCTCAAGAACAAGGACGCCGCCCTCTACAAG
TTCTGGCTGCTGCTCAAAAAGTTCCCCCGCTCCGTCCGCTACCTCCTCTACCTCTTCCCCGGCGCCGCCCTGCTG
CTCGTGCCCGTCCTCCTCGGCGGCATCGAGTTCCGCCCCGACGACAAGCTCGTCGGCGGCGTCGGCGGCGTCCAG
CTCATGTGGTTCGGCATCTGGCTCGAGGTCGTCTGGTGCTCGCTCTGGCTGTCGCGCCTGCTCACAAGTCTGCTG
CCCAGCCTCTTCTACACCGTCGCCCACGTCGGCGGCTCCATCAACGCCCGTAAGTGGAAGGAGATTGGCAGCCGG
CTCGAGCTGCCCACCGCCCTCTTCCTCTGGTTCCTCGCCATCCTCGTCTCCTTCAAGCCCACCACCGACGGCCAC
CGCGGCCGCGTGCCGCCCGGCCGCGACGCCGACGTCGGCGTCGCCTGGATCGACGTCGTCAACAAGGTCATCATC
GCCCTCTTCACCCTCGCCACCCTCAACCTGGTGGAGAAGCTGGTGATCCAGTGGATCGCCACCTCCTTCCACCAG
CGCACCTACTCGACCCGCATCGAGAACAACAAGGCCGACACGCTCCACCTCGTCCGGCTGTACGAGTATGCCAAG
GCCAAGCTCGAGCACAGCGACAGCTTCTGGCAGCGCGCCACCGGCACCACCAACACCGGCGCCCACACGCCCCTC
AAGTCGCTGCACAACAACGCCCGCCACGTGCTGGGCAAGGTCGGCCAGGTGGCCAACCGCGTCGGCAACGACCTC
ATCGGCCGCAAGGTCAACACCAACGTGCCGCGCAAGGTCGTCTCCGAGCTCCTCCGCACCACGACCGCCTCGCAC
AGCCTGGCCCGCCTCATCTACCGCAGCCTCGTCCGCGACGGCCGCGACACCGTCTACCCGGACGACCTGGCCGTC
GTCTTCGACGAGCAGGACGACATCGACGCCACCTTCAGCGTCTTCGACAAGGACCTCAACGGCGACATCTCCATC
GACGAGTTCGAGGCCGTCTGCAACGAGATCCACCTGGAGAAGAAGGCCATCGCCGCCTCGCTCAAGGACCTCGAC
TCCGTCATCCGCAAGCTCGACAACGTCTTCCTCTTCATCATCGTCGTCATCGCCATCATCGTCTTCATCTCCATC
CTGTCCGGCTCCGCCGCCGCCGGCCTCGCCTCCGCCGGCACCTCCTTCCTCGGCCTGGCCTGGATGCTGCAGGCC
ACGGCCCAGGAGTTTCTGCAGTCCGTCATCTTCGTCTTCATCAAGCACCCCTTCGACGTCGGCGACCGCGTCACC
ATCTACGGCTCCACCGGCGCCGACATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail