Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3675
Gene name
LocationContig_199:13272..16317
Strand-
Gene length (bp)3045
Transcript length (bp)2457
Coding sequence length (bp)2457
Protein length (aa) 819

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 5.9E-03 509 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 509 590 5.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 511 606 7.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 511 606 7.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 511 606 9.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 511 606 1.0E-05
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34708|TRA1_CAEEL Sex-determining transformer protein 1 OS=Caenorhabditis elegans GN=tra-1 PE=1 SV=1 509 590 5.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 511 606 7.0E-06
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 511 606 7.0E-06
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 511 606 9.0E-06
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 511 606 1.0E-05
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 511 606 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3675
MDQYDESQPVEGTPQPWNIYNFYAAPAKSDPWVPLGVIPPSVPDDPPGRAVPSEQFASQPSFLDWRSTGSPSECA
TLPQDSGYGSIRQSYSIASASVHGGDDMVLDSQMGQVMGECHINNPEASQFDPQHHQPATGKYRCPDCSTWLKSP
GELKKHTQRHIKSFKCPYVDCAKRQRGFSTANDLVRHKRSVHGDHSLPGRSFVCPYCVPGSKGPKIWPRADNFRS
HLSRSHNLKLKSEDDHGKYIFQPPLRRNDLDGVGDSLELVDSRARPMSLQESPALSEGPRCDVGPHFFGGQMAQQ
QTAEPPTVTRPDVNPTLSRPPRNVAAEPAVATVASPASQESPCVRPDALSRPVGFVVARTQGQTPVHTLHAQPEN
VVHPRGSLSHLTHTDGDHDDNSDSNDGSDLCDDDCDDEDDNDNDDDCGDGRGAGPYASAPTSMDAAPLGQSQSAT
GTKCEETWNLGASDCTMPWLASWHKPGGDESSRLLGETGLEGELEGQSDNDASPRAHVECPECEKIFSRRCELKK
HFKRHLKPYGCTFKSCLKRFGSKNDWKRHESSQHFLLEKWDCDEPNCTKICQRRESFKSHLQRDHNMSDSDKIDE
KLETCRLGRHCDPRFWCGFCVKIIQIDMNEKGGNSWTKRCDHIDNHLFGKEGLQKKSIKDWIHQEDQLEHPASTT
AGATDPQPANRTEAGDGEGLERKRRSSGGTSSRPCKRASKSQATTYMWICCMCAAEMVLKTSSSCFETTWDRTWD
RTWDRTWDRTWRWRQRLRRRKLVQQPSQSGLKGKTEQGLEGRRYRPCLYLGLDSRRADGGGFQASESM*
Coding >Hirsu2|3675
ATGGATCAATACGATGAATCTCAACCGGTCGAGGGCACGCCGCAGCCATGGAATATCTACAACTTCTACGCTGCG
CCCGCCAAGAGCGACCCTTGGGTTCCCCTTGGCGTCATCCCGCCCTCGGTGCCGGACGACCCACCCGGCCGTGCC
GTGCCCTCGGAGCAGTTCGCCTCTCAGCCCAGCTTTCTCGACTGGAGGAGTACCGGCTCGCCGTCCGAATGCGCC
ACACTACCCCAAGACTCGGGATACGGAAGCATCCGCCAATCGTACAGTATAGCGAGCGCCTCCGTCCACGGCGGC
GACGACATGGTCCTGGACTCGCAAATGGGTCAGGTCATGGGCGAATGCCACATCAATAACCCCGAGGCATCACAG
TTCGATCCGCAGCATCACCAGCCGGCGACTGGAAAGTACCGCTGCCCAGACTGCAGCACTTGGCTCAAGAGCCCA
GGCGAGCTCAAAAAGCATACGCAGCGCCACATCAAGTCCTTCAAATGTCCCTATGTCGACTGCGCCAAGAGGCAG
CGAGGATTTAGTACTGCGAATGATCTCGTGCGACACAAGAGATCGGTTCACGGCGATCACAGCCTGCCAGGCCGG
TCTTTCGTCTGCCCTTACTGCGTGCCCGGGAGCAAGGGACCCAAGATATGGCCGAGGGCAGACAACTTTCGCTCT
CACCTGTCCCGCTCACATAACCTGAAGCTCAAATCGGAAGATGACCATGGAAAATACATATTCCAGCCGCCATTG
CGGAGGAACGATCTAGACGGTGTTGGCGACTCCCTCGAACTCGTCGATTCGAGGGCTCGGCCGATGAGTCTCCAA
GAGTCTCCGGCTCTGTCGGAAGGCCCGCGTTGCGACGTCGGTCCGCACTTCTTCGGGGGCCAAATGGCGCAGCAG
CAAACTGCGGAGCCGCCGACGGTAACTCGGCCGGACGTCAATCCCACGCTTTCCCGGCCACCCCGCAATGTGGCG
GCCGAACCGGCGGTGGCCACGGTTGCGTCCCCGGCCAGTCAGGAGTCTCCATGCGTCCGGCCAGACGCCCTTAGC
CGGCCCGTTGGCTTTGTCGTCGCCCGTACACAAGGCCAGACCCCTGTGCACACGCTGCATGCGCAGCCCGAGAAC
GTTGTCCACCCTCGCGGCAGCCTCTCTCACCTTACTCACACCGATGGTGACCACGACGACAACAGCGACAGCAAT
GATGGCAGCGACCTTTGTGACGACGATTGTGACGACGAAGACGACAACGACAATGATGATGATTGTGGCGACGGC
CGCGGCGCTGGGCCCTATGCCTCTGCTCCCACATCCATGGACGCCGCACCACTCGGGCAATCGCAGTCAGCCACA
GGCACAAAATGTGAAGAGACCTGGAATCTGGGCGCTTCAGATTGCACGATGCCATGGCTTGCCAGCTGGCACAAG
CCTGGAGGCGATGAGAGTAGCCGCCTCCTGGGCGAGACGGGGCTAGAGGGAGAGCTCGAGGGTCAGTCCGACAAC
GACGCAAGTCCAAGGGCTCATGTCGAGTGCCCAGAATGTGAAAAGATCTTCAGCCGGCGGTGCGAGCTCAAGAAA
CACTTCAAACGGCACCTCAAACCTTACGGGTGCACGTTCAAAAGCTGTCTGAAGAGATTTGGAAGTAAGAACGAC
TGGAAGAGGCACGAAAGCAGCCAACATTTCTTGCTCGAGAAATGGGACTGCGACGAGCCCAACTGCACCAAGATT
TGCCAGCGTCGGGAAAGCTTCAAGAGCCACTTGCAAAGAGACCACAACATGAGCGACTCGGACAAGATTGACGAG
AAACTGGAGACGTGCCGGCTGGGGCGCCACTGCGACCCGCGCTTCTGGTGCGGCTTTTGCGTCAAGATCATCCAA
ATCGACATGAACGAAAAGGGGGGCAACTCTTGGACCAAGAGGTGCGACCACATCGACAACCACTTGTTTGGCAAG
GAGGGTCTGCAGAAGAAGTCGATCAAAGACTGGATACACCAAGAAGACCAGCTAGAACATCCGGCCTCGACAACG
GCGGGCGCCACGGATCCGCAGCCGGCCAACAGGACGGAGGCGGGCGATGGCGAAGGGCTGGAAAGAAAACGAAGA
AGCAGCGGCGGCACCAGCTCTCGGCCTTGCAAGAGGGCCAGCAAGTCACAGGCAACAACATACATGTGGATATGC
TGCATGTGCGCGGCGGAAATGGTGCTCAAGACGTCGTCCAGCTGCTTCGAGACGACGTGGGACCGGACGTGGGAC
CGGACGTGGGACCGGACGTGGGACCGGACGTGGAGATGGAGGCAGAGGCTTCGCAGGCGGAAGCTTGTGCAGCAA
CCGAGCCAGAGCGGGCTGAAGGGCAAGACGGAGCAGGGTCTCGAAGGACGCAGATACCGCCCCTGCCTCTACTTG
GGCCTTGACAGCAGACGGGCGGACGGGGGTGGGTTTCAGGCTTCCGAGAGTATGTAG
Transcript >Hirsu2|3675
ATGGATCAATACGATGAATCTCAACCGGTCGAGGGCACGCCGCAGCCATGGAATATCTACAACTTCTACGCTGCG
CCCGCCAAGAGCGACCCTTGGGTTCCCCTTGGCGTCATCCCGCCCTCGGTGCCGGACGACCCACCCGGCCGTGCC
GTGCCCTCGGAGCAGTTCGCCTCTCAGCCCAGCTTTCTCGACTGGAGGAGTACCGGCTCGCCGTCCGAATGCGCC
ACACTACCCCAAGACTCGGGATACGGAAGCATCCGCCAATCGTACAGTATAGCGAGCGCCTCCGTCCACGGCGGC
GACGACATGGTCCTGGACTCGCAAATGGGTCAGGTCATGGGCGAATGCCACATCAATAACCCCGAGGCATCACAG
TTCGATCCGCAGCATCACCAGCCGGCGACTGGAAAGTACCGCTGCCCAGACTGCAGCACTTGGCTCAAGAGCCCA
GGCGAGCTCAAAAAGCATACGCAGCGCCACATCAAGTCCTTCAAATGTCCCTATGTCGACTGCGCCAAGAGGCAG
CGAGGATTTAGTACTGCGAATGATCTCGTGCGACACAAGAGATCGGTTCACGGCGATCACAGCCTGCCAGGCCGG
TCTTTCGTCTGCCCTTACTGCGTGCCCGGGAGCAAGGGACCCAAGATATGGCCGAGGGCAGACAACTTTCGCTCT
CACCTGTCCCGCTCACATAACCTGAAGCTCAAATCGGAAGATGACCATGGAAAATACATATTCCAGCCGCCATTG
CGGAGGAACGATCTAGACGGTGTTGGCGACTCCCTCGAACTCGTCGATTCGAGGGCTCGGCCGATGAGTCTCCAA
GAGTCTCCGGCTCTGTCGGAAGGCCCGCGTTGCGACGTCGGTCCGCACTTCTTCGGGGGCCAAATGGCGCAGCAG
CAAACTGCGGAGCCGCCGACGGTAACTCGGCCGGACGTCAATCCCACGCTTTCCCGGCCACCCCGCAATGTGGCG
GCCGAACCGGCGGTGGCCACGGTTGCGTCCCCGGCCAGTCAGGAGTCTCCATGCGTCCGGCCAGACGCCCTTAGC
CGGCCCGTTGGCTTTGTCGTCGCCCGTACACAAGGCCAGACCCCTGTGCACACGCTGCATGCGCAGCCCGAGAAC
GTTGTCCACCCTCGCGGCAGCCTCTCTCACCTTACTCACACCGATGGTGACCACGACGACAACAGCGACAGCAAT
GATGGCAGCGACCTTTGTGACGACGATTGTGACGACGAAGACGACAACGACAATGATGATGATTGTGGCGACGGC
CGCGGCGCTGGGCCCTATGCCTCTGCTCCCACATCCATGGACGCCGCACCACTCGGGCAATCGCAGTCAGCCACA
GGCACAAAATGTGAAGAGACCTGGAATCTGGGCGCTTCAGATTGCACGATGCCATGGCTTGCCAGCTGGCACAAG
CCTGGAGGCGATGAGAGTAGCCGCCTCCTGGGCGAGACGGGGCTAGAGGGAGAGCTCGAGGGTCAGTCCGACAAC
GACGCAAGTCCAAGGGCTCATGTCGAGTGCCCAGAATGTGAAAAGATCTTCAGCCGGCGGTGCGAGCTCAAGAAA
CACTTCAAACGGCACCTCAAACCTTACGGGTGCACGTTCAAAAGCTGTCTGAAGAGATTTGGAAGTAAGAACGAC
TGGAAGAGGCACGAAAGCAGCCAACATTTCTTGCTCGAGAAATGGGACTGCGACGAGCCCAACTGCACCAAGATT
TGCCAGCGTCGGGAAAGCTTCAAGAGCCACTTGCAAAGAGACCACAACATGAGCGACTCGGACAAGATTGACGAG
AAACTGGAGACGTGCCGGCTGGGGCGCCACTGCGACCCGCGCTTCTGGTGCGGCTTTTGCGTCAAGATCATCCAA
ATCGACATGAACGAAAAGGGGGGCAACTCTTGGACCAAGAGGTGCGACCACATCGACAACCACTTGTTTGGCAAG
GAGGGTCTGCAGAAGAAGTCGATCAAAGACTGGATACACCAAGAAGACCAGCTAGAACATCCGGCCTCGACAACG
GCGGGCGCCACGGATCCGCAGCCGGCCAACAGGACGGAGGCGGGCGATGGCGAAGGGCTGGAAAGAAAACGAAGA
AGCAGCGGCGGCACCAGCTCTCGGCCTTGCAAGAGGGCCAGCAAGTCACAGGCAACAACATACATGTGGATATGC
TGCATGTGCGCGGCGGAAATGGTGCTCAAGACGTCGTCCAGCTGCTTCGAGACGACGTGGGACCGGACGTGGGAC
CGGACGTGGGACCGGACGTGGGACCGGACGTGGAGATGGAGGCAGAGGCTTCGCAGGCGGAAGCTTGTGCAGCAA
CCGAGCCAGAGCGGGCTGAAGGGCAAGACGGAGCAGGGTCTCGAAGGACGCAGATACCGCCCCTGCCTCTACTTG
GGCCTTGACAGCAGACGGGCGGACGGGGGTGGGTTTCAGGCTTCCGAGAGTATGTAG
Gene >Hirsu2|3675
ATGGATCAATACGATGAATCTCAACCGGTCGAGGGCACGCCGCAGCCATGGAATATCTACAACTTCTACGCTGCG
CCCGCCAAGAGCGACCCTTGGGTTCCCCTTGGCGTCATCCCGCCCTCGGTGCCGGACGACCCACCCGGCCGTGCC
GTGCCCTCGGAGCAGTTCGCCTCTCAGCCCAGCTTTCTCGACTGGAGGAGTACCGGCTCGCCGTCCGAATGCGCC
ACACTACCCCAAGACTCGGGATACGGAAGCATCCGCCAATCGTACAGTATAGCGAGCGCCTCCGTCCACGGCGGC
GACGACATGGTCCTGGACTCGCAAATGGGTCAGGTCATGGGCGAATGCCACATCAATAACCCCGAGGCATCACAG
TTCGATCCGCAGCATCACCAGCCGGCGACTGGAAAGTACCGCTGCCCAGACTGCAGCACTTGGCTCAAGAGCCCA
GGCGAGCTCAAGTAGGTTTCCGCTACCCGCCCCGCTCCGGGGCCTTTCACAGGCAAGCAGTCTATGGATCAAGGC
TGACGCGCGTCAACAATCAAAAGAAAGCATACGCAGCGCCACATCAAGTCCTTCAAATGTCCCTATGTCGACTGC
GCCAAGAGGCAGCGAGGATTTAGTACTGCGAATGATCTCGTGCGACACAAGAGATCGGTTCACGGCGATCACAGC
CTGCCAGGCCGGTCTTTCGTCTGCCCTTACTGCGTGCCCGGGAGCAAGGGACCCAAGATATGGCCGAGGGCAGAC
AACTTTCGCTCTCACCTGTCCCGCTCACATAACCTGAAGCTCAAATCGGAAGATGACCATGGAAAATACATATTC
CAGTATGTTTGACCGCCACACAACTCCGGCTGTGGATCAGTTTGACAACTCTGCAGGCCGCCATTGCGGAGGAAC
GATCTAGACGGTGTTGGCGACTCCCTCGAACTCGTCGATTCGAGGGCTCGGCCGATGAGTCTCCAAGAGTCTCCG
GCTCTGTCGGAAGGCCCGCGTTGCGACGTCGGTCCGCACTTCTTCGGGGGCCAAATGGCGCAGCAGCAAACTGCG
GAGCCGCCGACGGTAACTCGGCCGGACGTCAATCCCACGCTTTCCCGGCCACCCCGCAATGTGGCGGCCGAACCG
GCGGTGGCCACGGTTGCGTCCCCGGCCAGTCAGGAGTCTCCATGCGTCCGGCCAGACGCCCTTAGCCGGCCCGTT
GGCTTTGTCGTCGCCCGTACACAAGGCCAGACCCCTGTGCACACGCTGCATGCGCAGCCCGAGAACGTTGTCCAC
CCTCGCGGCAGCCTCTCTCACCTTACTCACACCGATGGTGACCACGACGACAACAGCGACAGCAATGATGGCAGC
GACCTTTGTGACGACGATTGTGACGACGAAGACGACAACGACAATGATGATGATTGTGGCGACGGCCGCGGCGCT
GGGCCCTATGCCTCTGCTCCCACATCCATGGACGCCGCACCACTCGGGCAATCGCAGTCAGCCACAGGCACAAAA
TGTGAAGAGACCTGGAATCTGGGCGCTTCAGATTGCAGTGAGTCCACCCAAGTAGGGCTTCGTGATCTCAGCGCC
GACATGGTGGGCTCGCAGCGATGCCATGGCTTGCCAGCTGGCACAAGCCTGGAGGCGATGAGAGTAGCCGCCTCC
TGTATGGAGCCTGGGCGCTCTGATAACATCATCAAGTTTCTCCAAAGTTTCCCTAAAGAGCTCCTTGAATCGGCA
CTTAGGGGCGAGACGGGGCTAGAGGGAGAGCTCGAGGGTCAGTCCGACAACGACGCAAGTCCAAGGGCTCATGTC
GAGTGCCCAGAATGTGAAAAGATCTTCAGCCGGCGGTGCGAGCTCAAGTAAGCCATGCTCACGACTCCCTCCGTC
CCAGACGTCTGCGGGGGTCGTTTTTTTTTTTCGTCGCCGCTGACAGGTGTGCCGTCCAAGGAAACACTTCAAACG
GCACCTCAAACCTTACGGGTGCACGTTCAAAAGCTGTCTGAAGAGATTTGGAAGTAAGAACGACTGGAAGAGGCA
CGAAAGCAGCCAACATTTCTTGCTCGAGAAATGGGACTGCGACGAGCCCAACTGCACCAAGATTTGCCAGCGTCG
GGAAAGCTTCAAGAGCCACTTGCAAAGAGACCACAACATGAGCGACTCGGACAAGATTGACGAGAAACTGGAGAC
GTGCCGGCTGGGGCGCCACTGCGACCCGCGCTTCTGGTGCGGCTTTTGCGTCAAGATCATCCAAATCGACATGAA
CGAAAAGGGGGGCAACTCTTGGACCAAGAGGTGCGACCACATCGACAACCACTTGTTTGGCAAGGAGGGTCTGCA
GAAGAAGTCGATCAAAGACTGGATACACCAAGAAGACCAGCTAGAACATCCGGCCTCGACAACGGCGGGCGCCAC
GGATCCGCAGCCGGCCAACAGGACGGAGGCGGGCGATGGCGAAGGGCTGGAAAGAAAACGAAGAAGCAGCGGCGG
CACCAGCTCTCGGCCTTGCAAGAGGGCCAGCAAGTCACAGGCAACAACATACATGTGGATATGCGTAAGTTGTGA
AGCATTTCTCGAGTCGTCTCCTCGTTTACCTGACGCTCATTATCACTATTCCCCCCGTTTACTCTCCTTCGGTCG
GCTACGCACTTTTCCCCTCTGATTTCTCACCAACGTGTCGTATTGGATGGTGATGCGGACAAGGAGGCTCACACA
GATGACAGTGCATGTGCGCGGCGGAAATGGTGCTCAAGACGTCGTCCAGCTGCTTCGAGTGCCATCATCCAAGAT
GTTCGGCCGACTGCGAAGTGATAACGATTTCGCCACAGGACGACGTGGGACCGGACGTGGGACCGGACGTGGGAC
CGGACGTGGGACCGGACGTGGAGATGGAGGCAGAGGCTTCGCAGGCGGAAGCTTGTGCAGCAACCGAGCCAGAGC
GGGCTGAAGGGCAAGACGGAGCAGGGTCTCGAAGGACGCAGATACCGCCCCTGCCTCTACTTGGGCCTTGACAGC
AGACGGGCGGACGGGGGTGGGTTTCAGGCTTCCGAGAGTATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail