Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3672
Gene name
LocationContig_1989:532..1291
Strand-
Gene length (bp)759
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 1.7E-53 2 123

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 2 120 6.0E-33
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 12 119 7.0E-29

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 62 84 22
3 99 121 22
4 128 147 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3672
MSGIATLGRFFEGEAIFSGLAHWIKGGVFFWLGLFTLGRWTGSFGDLGWAWNVRPQTKLRKWCPTAELVECALIF
SYGSTNIFLEHLGHWGGAWRPQDLEHVAITILFIGGGLCGMLVESCRDSRKAASPAWFTSSGAIYCWVLLVLEV*
Coding >Hirsu2|3672
ATGTCAGGAATTGCCACCCTCGGTCGCTTTTTTGAAGGCGAAGCGATTTTCAGCGGACTGGCACATTGGATCAAA
GGCGGTGTTTTTTTCTGGCTAGGCCTCTTTACTCTTGGCCGCTGGACGGGGAGCTTCGGAGACCTTGGCTGGGCC
TGGAACGTACGACCGCAAACGAAGCTGCGAAAATGGTGCCCTACGGCTGAACTGGTGGAGTGTGCTCTCATCTTC
TCCTACGGCTCCACCAATATCTTCCTCGAGCACCTCGGTCACTGGGGTGGGGCTTGGAGGCCCCAAGACCTGGAG
CATGTTGCCATCACAATCTTGTTTATCGGTGGCGGCCTGTGCGGCATGCTCGTAGAGTCGTGCCGCGACAGTCGC
AAAGCGGCATCTCCAGCATGGTTCACAAGCAGTGGGGCAATCTACTGCTGGGTGCTTCTTGTGCTCGAGGTCTGA
Transcript >Hirsu2|3672
ATGTCAGGAATTGCCACCCTCGGTCGCTTTTTTGAAGGCGAAGCGATTTTCAGCGGACTGGCACATTGGATCAAA
GGCGGTGTTTTTTTCTGGCTAGGCCTCTTTACTCTTGGCCGCTGGACGGGGAGCTTCGGAGACCTTGGCTGGGCC
TGGAACGTACGACCGCAAACGAAGCTGCGAAAATGGTGCCCTACGGCTGAACTGGTGGAGTGTGCTCTCATCTTC
TCCTACGGCTCCACCAATATCTTCCTCGAGCACCTCGGTCACTGGGGTGGGGCTTGGAGGCCCCAAGACCTGGAG
CATGTTGCCATCACAATCTTGTTTATCGGTGGCGGCCTGTGCGGCATGCTCGTAGAGTCGTGCCGCGACAGTCGC
AAAGCGGCATCTCCAGCATGGTTCACAAGCAGTGGGGCAATCTACTGCTGGGTGCTTCTTGTGCTCGAGGTCTGA
Gene >Hirsu2|3672
ATGTCAGGAATTGCCACCCTCGGTCGCTTTTTTGTAAGTTGACTACTGCAACTTCCTATAATGCAGCGCGTTCCG
CGTCCCGAGCTTATCTCTCACTGACCGCCCCCAGGAAGGCGAAGCGATTTTCAGCGGACTGGCACATTGGATCAA
AGGCGGTGTTTTTTTCTGGCTAGGCCTCTTTACTCTTGGCCGCTGGACGGGGAGCTTCGGAGACCTTGGCTGGGC
CTGGAACGTACGACCGCAAACGAAGCTGCGAAAATGGTGCCCTACGGCTGAACTGGTGGAGTGTGCTCTCATCTT
CTCCTACGGCTCCACCAATATCTTCCTCGAGCACCTCGGTCACTGGGGTGGGGCTTGGAGGCCCCAAGACCTGGA
GCATGTTGCCATCACAATCTTGTTTATCGGTGGCGGCCTGGTAAGCAGGATTCGTTGACCTCTTCAAGTTCAAGA
CTCGAAAATACGCATGCTAACTGACGGCTGCGGCATAGTGCGGCATGCTCGTAGAGTCGTGCCGCGTACGTGACT
TGCTTAATACCACTGTTTTGGAGGTATTGCCCGGCGGCGAATTGTCTGAGGAAGGACAGTCGCAAAGGTCTGTTC
CGGAAACTTACAAACTCTCCTTGAACCCCATTCCCGCACTCGTCATCTTGATGCTGGGCATTACTATGAGTTCTC
ACCAGCAGTCCAGCGGCATCTCCAGCATGGTTCACAAGCAGTGGGGCAATCTACTGCTGGGTGCTTCTTGTGCTC
GAGGTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail