Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3658
Gene name
LocationContig_198:15612..16528
Strand-
Gene length (bp)916
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6203 0.6702 0.0226 0.038 0.0636 0.0025 0.1136 0.0883 0.0457 0.0123

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9397
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|3658 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3658
MSAPYWGQLPEPSVAREREGGRRPSADRYDDYPPLDYRQSLDGPSRRKSTRAPGPPTATDAPHESTFSPRAPAVS
TFPGHGLASRPPVFPRAGPLETGLDAPERWSRPPPHRPGGPGRSDPSAFSAQSAAVPRGPPASYRHPYGNGALPY
TYPSPVNARPPMPHPGQQYHQPLPQQHPGPPQQHPPPTQQHPPPPQQHPPPPQQHPPPQQHPLQHYPPQQQPQQL
PRDEEANAQEPHYTTSRNPQPESLLRPMQHPSSRSAEES*
Coding >Hirsu2|3658
ATGTCAGCCCCCTACTGGGGCCAGCTTCCCGAGCCCAGCGTGGCGAGGGAGCGAGAAGGCGGCCGCCGCCCATCG
GCCGACAGGTACGACGACTACCCGCCCCTCGACTACCGCCAATCGCTCGACGGGCCGTCTCGTCGCAAGTCGACC
CGGGCCCCGGGCCCGCCCACCGCTACCGACGCTCCCCACGAGTCTACCTTTAGTCCGCGCGCACCGGCCGTCTCG
ACATTCCCGGGCCACGGCCTGGCCTCGAGACCGCCCGTCTTCCCCCGCGCCGGCCCTCTGGAGACGGGCCTGGAT
GCGCCCGAGCGCTGGTCTCGACCCCCTCCCCACCGCCCCGGCGGCCCCGGCCGCAGTGACCCGTCCGCCTTTTCG
GCCCAGTCCGCCGCCGTCCCTCGAGGCCCTCCCGCCAGCTATCGTCATCCGTACGGCAATGGCGCCCTGCCCTAC
ACCTACCCCTCTCCCGTGAATGCCAGGCCTCCCATGCCGCACCCCGGTCAGCAGTACCATCAGCCTCTGCCGCAG
CAGCATCCTGGGCCGCCGCAGCAGCATCCTCCCCCGACGCAGCAGCATCCTCCGCCGCCGCAGCAGCATCCTCCG
CCGCCGCAGCAGCATCCTCCGCCGCAGCAGCATCCTTTGCAGCATTATCCTCCGCAGCAGCAGCCCCAGCAGCTG
CCTCGCGATGAAGAGGCCAACGCCCAGGAACCACACTATACTACAAGCCGCAACCCACAGCCCGAATCCTTACTG
CGTCCAATGCAGCATCCATCATCCAGAAGCGCCGAAGAATCATGA
Transcript >Hirsu2|3658
ATGTCAGCCCCCTACTGGGGCCAGCTTCCCGAGCCCAGCGTGGCGAGGGAGCGAGAAGGCGGCCGCCGCCCATCG
GCCGACAGGTACGACGACTACCCGCCCCTCGACTACCGCCAATCGCTCGACGGGCCGTCTCGTCGCAAGTCGACC
CGGGCCCCGGGCCCGCCCACCGCTACCGACGCTCCCCACGAGTCTACCTTTAGTCCGCGCGCACCGGCCGTCTCG
ACATTCCCGGGCCACGGCCTGGCCTCGAGACCGCCCGTCTTCCCCCGCGCCGGCCCTCTGGAGACGGGCCTGGAT
GCGCCCGAGCGCTGGTCTCGACCCCCTCCCCACCGCCCCGGCGGCCCCGGCCGCAGTGACCCGTCCGCCTTTTCG
GCCCAGTCCGCCGCCGTCCCTCGAGGCCCTCCCGCCAGCTATCGTCATCCGTACGGCAATGGCGCCCTGCCCTAC
ACCTACCCCTCTCCCGTGAATGCCAGGCCTCCCATGCCGCACCCCGGTCAGCAGTACCATCAGCCTCTGCCGCAG
CAGCATCCTGGGCCGCCGCAGCAGCATCCTCCCCCGACGCAGCAGCATCCTCCGCCGCCGCAGCAGCATCCTCCG
CCGCCGCAGCAGCATCCTCCGCCGCAGCAGCATCCTTTGCAGCATTATCCTCCGCAGCAGCAGCCCCAGCAGCTG
CCTCGCGATGAAGAGGCCAACGCCCAGGAACCACACTATACTACAAGCCGCAACCCACAGCCCGAATCCTTACTG
CGTCCAATGCAGCATCCATCATCCAGAAGCGCCGAAGAATCATGA
Gene >Hirsu2|3658
ATGTCAGCCCCCTACTGGGGCCAGCTTCCCGAGCCCAGCGTGGCGAGGGAGCGAGAAGGCGGCCGCCGCCCATCG
GCCGACAGGTACGACGACTACCCGCCCCTCGACTACCGCCAATCGCTCGACGGGCCGTCTCGTCGCAAGTCGACC
CGGGCCCCGGGCCCGCCCACCGCTACCGACGCTCCCCACGAGTCTACCTTTAGTCCGCGCGCACCGGCCGTCTCG
ACATTCCCGGGCCACGGCCTGGCCTCGAGACCGCCCGTCTTCCCCCGCGCCGGCCCTCTGGAGACGGGCCTGGAT
GCGCCCGAGCGCTGGTCTCGACCCCCTCCCCACCGCCCCGGCGGCCCCGGCCGCAGTGACCCGTCCGCCTTTTCG
GCCCAGTCCGCCGCCGTCCCTCGAGGCCCTCCCGCCAGCTATCGTCATCCGTACGGCAATGGCGCCCTGCCCTAC
ACCTACCCCTCTCCCGTGAATGCCAGGCCTCCCATGCCGCACCCCGGTCAGCAGTACCATCAGCCTCTGCCGCAG
CAGCATCCTGGGCCGCCGCAGCAGCATCCTCCCCCGACGCAGCAGCATCCTCCGCCGCCGCAGCAGCATCCTCCG
CCGCCGCAGCAGCATCCTCCGCCGCAGCAGCATCCTTTGCAGCATTATCCTCCGCAGCAGCAGCCCCAGCAGCTG
CCTCGCGATGAAGAGGCCAACGCCCAGGAACCACACTATACTACAAGCCGCAACCCACAGCCCGAATCCTTACTG
CGTCCAATGCAGCATCCATCATCCAGAGTAGATGGCCCGACCGTTGACCAAGAGGCGGCTGCCCCGTCCCGGGAT
CCGTCAACGACTGCATCGTCAGAGCGCCGAAGAATGTTCGCAAACGACCGATCACCTCTGCAAAGGCTTGAGCTG
ACGCTCGACAGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail