Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3651
Gene name
LocationContig_1978:1696..3634
Strand+
Gene length (bp)1938
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 5.4E-29 2 160
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 1.4E-21 185 297
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 1.1E-11 383 461

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WXX9|PDC_ASPFU Pyruvate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pdcA PE=3 SV=1 1 544 0.0E+00
sp|P87208|PDC_EMENI Pyruvate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pdcA PE=3 SV=3 1 544 0.0E+00
sp|Q0CNV1|PDC_ASPTN Pyruvate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pdcA PE=3 SV=1 1 545 0.0E+00
sp|Q2UKV4|PDC_ASPOR Pyruvate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdcA PE=3 SV=1 1 544 0.0E+00
sp|Q09737|PDC1_SCHPO Putative pyruvate decarboxylase C13A11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13A11.06 PE=3 SV=2 1 546 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WXX9|PDC_ASPFU Pyruvate decarboxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pdcA PE=3 SV=1 1 544 0.0E+00
sp|P87208|PDC_EMENI Pyruvate decarboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pdcA PE=3 SV=3 1 544 0.0E+00
sp|Q0CNV1|PDC_ASPTN Pyruvate decarboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pdcA PE=3 SV=1 1 545 0.0E+00
sp|Q2UKV4|PDC_ASPOR Pyruvate decarboxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdcA PE=3 SV=1 1 544 0.0E+00
sp|Q09737|PDC1_SCHPO Putative pyruvate decarboxylase C13A11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13A11.06 PE=3 SV=2 1 546 0.0E+00
sp|Q6FJA3|PDC1_CANGA Pyruvate decarboxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDC1 PE=3 SV=1 3 548 8.0E-173
sp|P34734|PDC_HANUV Pyruvate decarboxylase OS=Hanseniaspora uvarum GN=PDC PE=3 SV=1 1 548 1.0E-172
sp|O42873|PDC4_SCHPO Putative pyruvate decarboxylase C3G9.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3G9.11c PE=3 SV=1 1 546 2.0E-170
sp|P16467|PDC5_YEAST Pyruvate decarboxylase isozyme 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC5 PE=1 SV=4 5 546 4.0E-170
sp|P33149|PDC1_KLUMA Pyruvate decarboxylase OS=Kluyveromyces marxianus GN=PDC1 PE=3 SV=1 3 548 4.0E-169
sp|P26263|PDC6_YEAST Pyruvate decarboxylase isozyme 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC6 PE=1 SV=3 1 546 1.0E-168
sp|P06169|PDC1_YEAST Pyruvate decarboxylase isozyme 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDC1 PE=1 SV=7 3 546 1.0E-167
sp|Q12629|PDC1_KLULA Pyruvate decarboxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PDC1 PE=1 SV=2 3 546 1.0E-166
sp|P83779|PDC1_CANAL Pyruvate decarboxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PDC11 PE=1 SV=2 1 546 8.0E-158
sp|Q07471|THI3_YEAST Thiamine metabolism regulatory protein THI3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI3 PE=1 SV=1 1 534 1.0E-140
sp|P51844|PDC_ASPPA Pyruvate decarboxylase OS=Aspergillus parasiticus GN=pdcA PE=3 SV=1 1 534 1.0E-110
sp|Q9CBD6|KDC_MYCLE Alpha-keto-acid decarboxylase OS=Mycobacterium leprae (strain TN) GN=kdc PE=3 SV=1 1 544 8.0E-105
sp|Q742Q2|KDC_MYCPA Alpha-keto-acid decarboxylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=kdc PE=3 SV=1 1 534 2.0E-101
sp|A0QBE6|KDC_MYCA1 Alpha-keto-acid decarboxylase OS=Mycobacterium avium (strain 104) GN=kdc PE=3 SV=2 1 534 1.0E-100
sp|P23234|DCIP_ENTCL Indole-3-pyruvate decarboxylase OS=Enterobacter cloacae GN=ipdC PE=1 SV=1 2 545 3.0E-97
sp|P9WG37|KDC_MYCTU Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdc PE=1 SV=1 1 533 2.0E-96
sp|A5U0P1|KDC_MYCTA Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=kdc PE=3 SV=1 1 533 2.0E-96
sp|A1KGY5|KDC_MYCBP Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=kdc PE=3 SV=1 1 533 2.0E-96
sp|Q7U140|KDC_MYCBO Alpha-keto-acid decarboxylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdc PE=3 SV=1 1 533 2.0E-96
sp|P9WG36|KDC_MYCTO Alpha-keto-acid decarboxylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdc PE=3 SV=1 1 533 1.0E-95
sp|A0R480|KDC_MYCS2 Alpha-keto-acid decarboxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=kdc PE=3 SV=1 1 546 6.0E-93
sp|A0PL16|KDC_MYCUA Alpha-keto-acid decarboxylase OS=Mycobacterium ulcerans (strain Agy99) GN=kdc PE=3 SV=1 1 533 1.0E-90
sp|Q06408|ARO10_YEAST Transaminated amino acid decarboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARO10 PE=1 SV=1 4 546 4.0E-81
sp|Q92345|PDC2_SCHPO Probable pyruvate decarboxylase C1F8.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F8.07c PE=1 SV=3 1 546 2.0E-80
sp|A2Y5L9|PDC1_ORYSI Pyruvate decarboxylase 1 OS=Oryza sativa subsp. indica GN=PDC1 PE=2 SV=1 1 546 8.0E-80
sp|Q9M040|PDC4_ARATH Pyruvate decarboxylase 4 OS=Arabidopsis thaliana GN=PDC4 PE=2 SV=1 2 546 2.0E-79
sp|Q0DHF6|PDC1_ORYSJ Pyruvate decarboxylase 1 OS=Oryza sativa subsp. japonica GN=PDC1 PE=2 SV=1 1 546 3.0E-79
sp|P28516|PDC1_MAIZE Pyruvate decarboxylase 1 OS=Zea mays GN=PDC1 PE=2 SV=1 1 546 1.0E-78
sp|Q9M039|PDC3_ARATH Pyruvate decarboxylase 3 OS=Arabidopsis thaliana GN=PDC3 PE=2 SV=1 2 546 2.0E-77
sp|Q9P7P6|PDC3_SCHPO Probable pyruvate decarboxylase C186.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.09 PE=3 SV=1 2 534 2.0E-76
sp|P51846|PDC2_TOBAC Pyruvate decarboxylase 2 OS=Nicotiana tabacum GN=PDC2 PE=2 SV=1 1 546 2.0E-75
sp|O82647|PDC1_ARATH Pyruvate decarboxylase 1 OS=Arabidopsis thaliana GN=PDC1 PE=2 SV=1 2 546 6.0E-75
sp|A2XFI3|PDC2_ORYSI Pyruvate decarboxylase 2 OS=Oryza sativa subsp. indica GN=PDC2 PE=2 SV=2 1 546 3.0E-74
sp|Q9FFT4|PDC2_ARATH Pyruvate decarboxylase 2 OS=Arabidopsis thaliana GN=PDC2 PE=2 SV=1 1 546 2.0E-73
sp|Q10MW3|PDC2_ORYSJ Pyruvate decarboxylase 2 OS=Oryza sativa subsp. japonica GN=PDC2 PE=2 SV=1 1 546 4.0E-73
sp|P51850|PDC1_PEA Pyruvate decarboxylase 1 OS=Pisum sativum GN=PDC1 PE=2 SV=1 1 546 4.0E-70
sp|A2YQ76|PDC3_ORYSI Pyruvate decarboxylase 3 OS=Oryza sativa subsp. indica GN=PDC3 PE=3 SV=2 1 546 4.0E-68
sp|Q0D3D2|PDC3_ORYSJ Pyruvate decarboxylase 3 OS=Oryza sativa subsp. japonica GN=PDC3 PE=2 SV=1 1 546 4.0E-68
sp|P33287|PDC_NEUCR Pyruvate decarboxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cfp PE=1 SV=1 1 546 4.0E-67
sp|P06672|PDC_ZYMMO Pyruvate decarboxylase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=pdc PE=1 SV=1 1 487 1.0E-55
sp|P51845|PDC1_TOBAC Pyruvate decarboxylase 1 (Fragment) OS=Nicotiana tabacum GN=PDC1 PE=2 SV=1 40 458 2.0E-44
sp|P51852|DCIP_AZOBR Indole-3-pyruvate decarboxylase OS=Azospirillum brasilense GN=ipdC PE=1 SV=1 2 526 7.0E-39
sp|P51851|PDC2_PEA Pyruvate decarboxylase 2 (Fragment) OS=Pisum sativum GN=PDC2 PE=2 SV=1 191 546 6.0E-34
sp|Q05327|PDC3_MAIZE Pyruvate decarboxylase 3 (Fragment) OS=Zea mays GN=PDC3 PE=2 SV=1 360 546 7.0E-27
sp|Q9LF46|HACL_ARATH 2-hydroxyacyl-CoA lyase OS=Arabidopsis thaliana GN=HACL PE=1 SV=1 25 509 4.0E-21
sp|O78518|ILVB_GUITH Acetolactate synthase large subunit OS=Guillardia theta GN=ilvB PE=3 SV=1 2 509 4.0E-20
sp|Q9QXE0|HACL1_MOUSE 2-hydroxyacyl-CoA lyase 1 OS=Mus musculus GN=Hacl1 PE=1 SV=2 23 509 5.0E-20
sp|Q8CHM7|HACL1_RAT 2-hydroxyacyl-CoA lyase 1 OS=Rattus norvegicus GN=Hacl1 PE=1 SV=1 23 509 1.0E-18
sp|Q57725|ILVB_METJA Probable acetolactate synthase large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvB PE=3 SV=1 2 455 8.0E-18
sp|D5AKX8|XSC_RHOCB Sulfoacetaldehyde acetyltransferase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=xsc PE=2 SV=1 2 515 6.0E-17
sp|P37251|ILVB_BACSU Acetolactate synthase large subunit OS=Bacillus subtilis (strain 168) GN=ilvB PE=1 SV=4 3 454 9.0E-17
sp|Q9UJ83|HACL1_HUMAN 2-hydroxyacyl-CoA lyase 1 OS=Homo sapiens GN=HACL1 PE=1 SV=2 23 503 5.0E-16
sp|Q9RQ65|ILVI_BUCSC Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schlechtendalia chinensis GN=ilvI PE=3 SV=1 2 457 1.0E-15
sp|P27868|ILVB_ARTPT Acetolactate synthase (Fragment) OS=Arthrospira platensis GN=ilvY PE=3 SV=1 2 457 1.0E-14
sp|P0A623|ILVB_MYCBO Acetolactate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvB PE=3 SV=1 1 456 1.0E-14
sp|P9WG41|ILVB1_MYCTU Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB1 PE=1 SV=1 1 456 1.0E-14
sp|P9WG40|ILVB1_MYCTO Acetolactate synthase large subunit IlvB1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvB1 PE=3 SV=1 1 456 1.0E-14
sp|O33112|ILVB_MYCLE Acetolactate synthase OS=Mycobacterium leprae (strain TN) GN=ilvB PE=3 SV=1 1 456 5.0E-14
sp|Q0JMH0|HACL_ORYSJ 2-hydroxyacyl-CoA lyase OS=Oryza sativa subsp. japonica GN=Os01g0505400 PE=3 SV=3 53 509 1.0E-13
sp|Q92EQ4|IOLD_LISIN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=iolD PE=3 SV=1 26 517 2.0E-13
sp|O85293|ILVI_BUCAP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ilvI PE=3 SV=1 2 454 2.0E-13
sp|Q84H41|XSC_ALCXX Sulfoacetaldehyde acetyltransferase OS=Alcaligenes xylosoxydans xylosoxydans GN=xsc PE=1 SV=3 2 461 4.0E-13
sp|O08353|ILVB_METAO Probable acetolactate synthase large subunit OS=Methanococcus aeolicus GN=ilvB PE=3 SV=1 3 491 4.0E-13
sp|P00893|ILVI_ECOLI Acetolactate synthase isozyme 3 large subunit OS=Escherichia coli (strain K12) GN=ilvI PE=1 SV=2 2 457 4.0E-13
sp|P40811|ILVI_SALTY Acetolactate synthase isozyme 3 large subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ilvI PE=3 SV=3 2 455 1.0E-12
sp|P00892|ILVG_ECOLI Acetolactate synthase isozyme 2 large subunit OS=Escherichia coli (strain K12) GN=ilvG PE=1 SV=3 2 461 2.0E-12
sp|O06335|ILVB2_MYCTU Putative acetolactate synthase large subunit IlvB2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvB2 PE=2 SV=1 2 456 3.0E-12
sp|Q89AP7|ILVI_BUCBP Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ilvI PE=3 SV=1 2 457 3.0E-12
sp|Q84H44|XSC_CASDE Sulfoacetaldehyde acetyltransferase OS=Castellaniella defragrans GN=xsc PE=1 SV=3 2 461 3.0E-12
sp|P45261|ILVI_HAEIN Acetolactate synthase large subunit OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ilvI PE=3 SV=1 2 457 4.0E-12
sp|Q59498|ILVB_MYCAV Acetolactate synthase OS=Mycobacterium avium GN=ilvB PE=3 SV=1 1 456 6.0E-12
sp|Q9LCV9|CEAS_STRCL N(2)-(2-carboxyethyl)arginine synthase OS=Streptomyces clavuligerus GN=ceaS PE=1 SV=1 25 487 6.0E-12
sp|P42463|ILVB_CORGL Acetolactate synthase large subunit OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvB PE=3 SV=1 6 456 3.0E-11
sp|P27696|ILVB_KLEPN Acetolactate synthase, catabolic OS=Klebsiella pneumoniae GN=budB PE=1 SV=1 2 459 8.0E-11
sp|P96591|YDAP_BACSU Putative thiamine pyrophosphate-containing protein YdaP OS=Bacillus subtilis (strain 168) GN=ydaP PE=2 SV=1 2 454 2.0E-10
sp|P08142|ILVB_ECOLI Acetolactate synthase isozyme 1 large subunit OS=Escherichia coli (strain K12) GN=ilvB PE=1 SV=1 2 459 2.0E-10
sp|P57321|ILVI_BUCAI Acetolactate synthase large subunit OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ilvI PE=3 SV=1 2 454 2.0E-10
sp|Q04789|ILVX_BACSU Acetolactate synthase OS=Bacillus subtilis (strain 168) GN=alsS PE=2 SV=3 2 480 2.0E-10
sp|Q58077|Y663_METJA Uncharacterized protein MJ0663 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0663 PE=3 SV=1 3 474 2.0E-10
sp|Q723S8|IOLD_LISMF 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=iolD PE=3 SV=2 26 526 5.0E-10
sp|Q92UW6|XSC_RHIME Probable sulfoacetaldehyde acetyltransferase OS=Rhizobium meliloti (strain 1021) GN=xsc PE=3 SV=1 2 452 7.0E-10
sp|P14874|ILVB2_BRANA Acetolactate synthase 2, chloroplastic OS=Brassica napus PE=3 SV=1 33 454 1.0E-09
sp|Q02137|ILVB_LACLA Acetolactate synthase large subunit OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvB PE=3 SV=2 1 461 2.0E-09
sp|P27818|ILVB1_BRANA Acetolactate synthase 1, chloroplastic OS=Brassica napus PE=3 SV=1 2 454 2.0E-09
sp|P27819|ILVB3_BRANA Acetolactate synthase 3, chloroplastic OS=Brassica napus PE=3 SV=1 2 454 2.0E-09
sp|P09342|ILVB1_TOBAC Acetolactate synthase 1, chloroplastic OS=Nicotiana tabacum GN=ALS SURA PE=1 SV=1 2 454 4.0E-09
sp|P09114|ILVB2_TOBAC Acetolactate synthase 2, chloroplastic OS=Nicotiana tabacum GN=ALS SURB PE=1 SV=1 2 454 4.0E-09
sp|Q5KYR0|IOLD_GEOKA 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Geobacillus kaustophilus (strain HTA426) GN=iolD PE=3 SV=1 33 457 1.0E-08
sp|Q8Y9Y1|IOLD_LISMO 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=iolD PE=3 SV=1 33 517 2.0E-08
sp|P17597|ILVB_ARATH Acetolactate synthase, chloroplastic OS=Arabidopsis thaliana GN=ALS PE=1 SV=1 2 454 2.0E-08
sp|Q5WKY8|IOLD_BACSK 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Bacillus clausii (strain KSM-K16) GN=iolD PE=3 SV=1 28 526 2.0E-08
sp|Q54DA9|HACL1_DICDI Probable 2-hydroxyacyl-CoA lyase 1 OS=Dictyostelium discoideum GN=hacl1 PE=3 SV=1 25 470 2.0E-08
sp|Q7U5G1|ILVB_SYNPX Acetolactate synthase large subunit OS=Synechococcus sp. (strain WH8102) GN=ilvB PE=3 SV=1 2 454 3.0E-08
sp|A4IPB6|IOLD_GEOTN 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=iolD PE=3 SV=1 33 457 5.0E-08
sp|P40149|OXC_OXAFO Oxalyl-CoA decarboxylase OS=Oxalobacter formigenes GN=oxc PE=1 SV=1 25 240 7.0E-08
sp|P07342|ILVB_YEAST Acetolactate synthase catalytic subunit, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ILV2 PE=1 SV=1 3 454 1.0E-07
sp|P0CH62|CHDH_AZOSP Cyclohexane-1,2-dione hydrolase OS=Azoarcus sp. PE=1 SV=1 24 457 2.0E-07
sp|P0AFI0|OXC_ECOLI Oxalyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=oxc PE=1 SV=1 54 240 6.0E-06
sp|P0AFI1|OXC_ECO57 Oxalyl-CoA decarboxylase OS=Escherichia coli O157:H7 GN=oxc PE=3 SV=1 54 240 6.0E-06
sp|Q9HUI8|ARUI_PSEAE Probable 2-ketoarginine decarboxylase AruI OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruI PE=1 SV=1 2 454 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000287 magnesium ion binding Yes
GO:0003824 catalytic activity Yes
GO:0030976 thiamine pyrophosphate binding Yes
GO:0050662 coenzyme binding No
GO:0046872 metal ion binding No
GO:1901681 sulfur compound binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0019842 vitamin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3651
MGVRSVHGVPGDYNLVALDYLPECGLKWVGSVNELNAAYAADGYARVKSIAALVTTFGVGELSAINGMAGAFSEH
IPVVHIVGCPSTISQRNGMLLHHTLGNGDFNVFANMNAQISCEVVKLNRPAEIADQIDHALRECWVSSRPVYVML
PTDMVQSQIEGERLVTPIDLSEPRNEPEREDYVVDVAMKCLRAATRPVILVDSCAIRHRVLNEVHSLINKAGLPV
FVTPMGKGAVDEQHPCYGGVYAGTGSFPIEVQNLVESSDLILTIGALKTDFNTTGFSYRTSQLNTIDLHSDHCVV
RYSTYPGVRMRGVLRKMIDIIDVKDLSVQRSPVVKNEVQKNLDGSQTITQAWFWPRMGLFLDDNDVVVTETGTSN
FGIWDTKFPSGVTALNQTLWGSIGWSVGACQGAALAVRDAGDNRRTILFVGDGSFQLTAQEVSTMIRLSLKPVIF
VICNKGFTIERFIHGVDADYNDISVWQYKDIVDVFGGKQTCRKFVVKTKDELNVLLDDADFKSAACLQFVELHMP
KMDAPRALVMTAEASAKNNARTD*
Coding >Hirsu2|3651
ATGGGCGTCCGTTCGGTCCATGGAGTTCCGGGCGATTACAACCTCGTCGCCCTCGACTATCTGCCAGAATGCGGC
CTGAAGTGGGTTGGTAGCGTAAACGAACTCAACGCTGCCTATGCCGCCGATGGCTACGCTCGTGTTAAGAGTATC
GCCGCCCTCGTTACCACCTTCGGAGTCGGTGAGCTTTCCGCCATCAACGGCATGGCCGGCGCCTTCTCGGAGCAT
ATACCCGTCGTTCACATTGTCGGCTGCCCGTCCACGATCTCGCAGCGCAACGGCATGCTTCTTCATCATACGCTT
GGCAACGGCGACTTCAACGTCTTCGCCAATATGAACGCCCAGATCTCGTGCGAGGTTGTCAAACTCAATCGGCCT
GCCGAAATTGCCGATCAAATCGACCACGCGTTGCGCGAATGCTGGGTCTCCTCGCGCCCAGTGTACGTGATGCTA
CCGACTGACATGGTCCAGAGCCAGATTGAGGGCGAGAGACTCGTGACTCCTATCGATCTCTCCGAGCCGCGGAAC
GAACCCGAAAGAGAAGACTACGTTGTTGATGTAGCCATGAAGTGCCTCCGCGCTGCAACGCGCCCCGTCATTCTC
GTTGACTCCTGTGCCATCCGCCACCGAGTCCTTAATGAGGTGCACAGTCTCATCAACAAGGCCGGCCTTCCTGTT
TTCGTGACTCCCATGGGCAAGGGTGCTGTCGACGAGCAGCATCCCTGTTACGGCGGTGTCTACGCCGGGACTGGT
TCTTTCCCCATCGAGGTCCAGAATCTCGTTGAGTCATCGGACCTTATTCTCACGATAGGCGCTCTCAAGACTGAC
TTCAATACTACTGGCTTCTCCTATCGCACTTCGCAGCTCAACACTATCGATTTGCACAGCGATCATTGCGTGGTG
AGATATTCGACCTATCCCGGCGTTCGCATGAGGGGTGTCTTGCGCAAGATGATCGACATCATCGATGTCAAGGAT
CTCTCCGTCCAGAGGTCTCCAGTCGTAAAGAACGAAGTGCAGAAGAATCTCGACGGCTCGCAGACTATTACACAG
GCCTGGTTCTGGCCTCGTATGGGGCTGTTCTTAGACGATAATGATGTGGTCGTGACAGAGACGGGGACTTCGAAC
TTTGGCATCTGGGACACCAAGTTTCCGTCGGGCGTGACGGCGCTGAACCAAACCCTGTGGGGAAGTATAGGATGG
TCCGTGGGCGCCTGTCAGGGTGCTGCCCTCGCCGTTCGAGACGCCGGTGATAACCGCAGAACTATCTTATTTGTC
GGAGATGGGTCGTTTCAGCTGACAGCCCAGGAAGTGAGCACCATGATTCGCCTCAGCTTGAAGCCCGTAATTTTT
GTCATTTGCAACAAGGGCTTTACCATCGAGCGCTTTATCCATGGTGTGGATGCAGATTATAACGACATATCAGTA
TGGCAATACAAAGACATCGTGGACGTGTTTGGCGGCAAGCAAACGTGTCGCAAGTTCGTCGTCAAAACCAAGGAC
GAACTGAATGTATTATTAGACGACGCCGACTTCAAGTCTGCAGCCTGTCTTCAGTTCGTTGAGCTGCATATGCCG
AAGATGGACGCGCCACGGGCTTTGGTCATGACGGCGGAAGCGAGTGCCAAAAACAACGCGAGGACGGACTAG
Transcript >Hirsu2|3651
ATGGGCGTCCGTTCGGTCCATGGAGTTCCGGGCGATTACAACCTCGTCGCCCTCGACTATCTGCCAGAATGCGGC
CTGAAGTGGGTTGGTAGCGTAAACGAACTCAACGCTGCCTATGCCGCCGATGGCTACGCTCGTGTTAAGAGTATC
GCCGCCCTCGTTACCACCTTCGGAGTCGGTGAGCTTTCCGCCATCAACGGCATGGCCGGCGCCTTCTCGGAGCAT
ATACCCGTCGTTCACATTGTCGGCTGCCCGTCCACGATCTCGCAGCGCAACGGCATGCTTCTTCATCATACGCTT
GGCAACGGCGACTTCAACGTCTTCGCCAATATGAACGCCCAGATCTCGTGCGAGGTTGTCAAACTCAATCGGCCT
GCCGAAATTGCCGATCAAATCGACCACGCGTTGCGCGAATGCTGGGTCTCCTCGCGCCCAGTGTACGTGATGCTA
CCGACTGACATGGTCCAGAGCCAGATTGAGGGCGAGAGACTCGTGACTCCTATCGATCTCTCCGAGCCGCGGAAC
GAACCCGAAAGAGAAGACTACGTTGTTGATGTAGCCATGAAGTGCCTCCGCGCTGCAACGCGCCCCGTCATTCTC
GTTGACTCCTGTGCCATCCGCCACCGAGTCCTTAATGAGGTGCACAGTCTCATCAACAAGGCCGGCCTTCCTGTT
TTCGTGACTCCCATGGGCAAGGGTGCTGTCGACGAGCAGCATCCCTGTTACGGCGGTGTCTACGCCGGGACTGGT
TCTTTCCCCATCGAGGTCCAGAATCTCGTTGAGTCATCGGACCTTATTCTCACGATAGGCGCTCTCAAGACTGAC
TTCAATACTACTGGCTTCTCCTATCGCACTTCGCAGCTCAACACTATCGATTTGCACAGCGATCATTGCGTGGTG
AGATATTCGACCTATCCCGGCGTTCGCATGAGGGGTGTCTTGCGCAAGATGATCGACATCATCGATGTCAAGGAT
CTCTCCGTCCAGAGGTCTCCAGTCGTAAAGAACGAAGTGCAGAAGAATCTCGACGGCTCGCAGACTATTACACAG
GCCTGGTTCTGGCCTCGTATGGGGCTGTTCTTAGACGATAATGATGTGGTCGTGACAGAGACGGGGACTTCGAAC
TTTGGCATCTGGGACACCAAGTTTCCGTCGGGCGTGACGGCGCTGAACCAAACCCTGTGGGGAAGTATAGGATGG
TCCGTGGGCGCCTGTCAGGGTGCTGCCCTCGCCGTTCGAGACGCCGGTGATAACCGCAGAACTATCTTATTTGTC
GGAGATGGGTCGTTTCAGCTGACAGCCCAGGAAGTGAGCACCATGATTCGCCTCAGCTTGAAGCCCGTAATTTTT
GTCATTTGCAACAAGGGCTTTACCATCGAGCGCTTTATCCATGGTGTGGATGCAGATTATAACGACATATCAGTA
TGGCAATACAAAGACATCGTGGACGTGTTTGGCGGCAAGCAAACGTGTCGCAAGTTCGTCGTCAAAACCAAGGAC
GAACTGAATGTATTATTAGACGACGCCGACTTCAAGTCTGCAGCCTGTCTTCAGTTCGTTGAGCTGCATATGCCG
AAGATGGACGCGCCACGGGCTTTGGTCATGACGGCGGAAGCGAGTGCCAAAAACAACGCGAGGACGGACTAG
Gene >Hirsu2|3651
ATGGGCGTCCGTTCGGTCCATGGAGTTCCGGGCGATTACAACCTCGTCGCCCTCGACTATCTGCCAGAATGCGGC
CTGAAGTGGGTTGGTAGCGTAAACGAACTCAACGCTGGTGAGTCTGCGGCCCTCGCGTTCCGCTGTTCCGGGCTC
GTCCCTAGCTGACGGCACATCATGCACGAGCCTATGCCGCCGATGGCTACGCTCGTGTTAAGAGTATCGCCGCCC
TCGTTACCACCTTCGGAGTCGGTGAGCTTTCCGCCATCAACGGCATGGCCGGCGCCTTCTCGGAGCATATACCCG
TCGTTCACATTGTCGGCTGCCCGTCCACGATCTCGCAGCGCAACGGCATGCTTCTTCATCATACGCTTGGCAACG
GCGACTTCAACGTCTTCGCCAATATGAACGCCCAGATCTCGTGCGAGGTTGTCAAACTCAATCGGCCTGCCGAAA
TTGCCGATCAAATCGACCACGCGTTGCGCGAATGCTGGGTCTCCTCGCGCCCAGTGTACGTGATGCTACCGACTG
ACATGGTCCAGAGCCAGATTGAGGGCGAGAGACTCGTGACTCCTATCGATCTCTCCGAGCCGCGGAACGAACCCG
AAAGAGAAGACTACGTTGTTGATGTAGCCATGAAGTGCCTCCGCGCTGCAACGCGCCCCGTCATTCTCGTTGACT
CCTGTGCCATCCGCCACCGAGTCCTTAATGAGGTGCACAGTCTCATCAACAAGGCCGGCCTTCCTGTTTTCGTGA
CTCCCATGGGCAAGGGTGCTGTCGACGAGCAGCATCCCTGTTACGGCGGTGTCTACGCCGGGACTGGTTCTTTCC
CCATCGAGGTCCAGAATCTCGTTGAGTCATCGGACCTTATTCTCACGATAGGCGCTCTCAAGGTGCTCTGATTGA
CCCATCTGCGTTACTGAATGCGGAACTTGTCGCGGCTAACTTGGATCAATCTGCAGACTGACTTCAATACTACTG
GCTTCTCCTATCGCACTTCGCAGCTCAACACTATCGATTTGCACAGCGATCATTGCGTGGTGAGATATTCGACCT
ATCCCGGCGTTCGCATGAGGGGTGTCTTGCGCAAGATGATCGACATCATCGATGTCAAGGATCTCTCCGTCCAGA
GGTCTCCAGTCGTAAAGAACGAAGTGCAGAAGAATCTCGACGGCTCGCAGACTATTACACAGGCCTGGTTCTGGC
CTCGTATGGGGCTGTTCTTAGACGATAATGATGTGGTCGTGACAGAGACGGGGACTTCGAACTTTGGCATCTGGG
ACACCAAGTTTCCGTCGGGCGTGACGGCGCTGAACCAAACCCTGTGGGGAAGTATAGGATGGTCCGTGGGCGCCT
GTCAGGGTGCTGCCCTCGCCGTTCGAGACGCCGGTGATAACCGCAGAACTATCTTATTTGTCGGAGATGGGTCGT
TTCAGCTGACAGCCCAGGAAGTGAGCACCATGATTCGCCTCAGCTTGAAGCCCGTAATGTGAGTCCCCTTAAGAC
AGTGATATCTCCACACCGCTCCGTCCGCCCCTTTCCCGAGGGAAGAAACAAAAGGGTGAGAAGAAAAGATAGCGA
CGGCGCAGACATAACTCATATAGAGGAAAAGCTCTGTGCCATGGCTGACTGTCTGAGGAAAGTTTTGTCATTTGC
AACAAGGGCTTTACCATCGAGCGCTTTATCCATGGTGTGGATGCAGATTATAACGACATATCAGTATGGCAATAC
AAAGACATCGTGGACGTGTTTGGCGGCAAGCAAACGTGTCGCAAGTTCGTCGTCAAAACCAAGGACGAACTGAAT
GTATTATTAGACGACGCCGACTTCAAGTCTGCAGCCTGTCTTCAGTTCGTTGAGCTGCATATGCCGAAGATGGAC
GCGCCACGGGCTTTGGTCATGACGGCGGAAGCGAGTGCCAAAAACAACGCGAGGACGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail