Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3647
Gene name
LocationContig_1975:963..3011
Strand+
Gene length (bp)2048
Transcript length (bp)1791
Coding sequence length (bp)1791
Protein length (aa) 597

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 2.4E-04 2 31

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0008270 zinc ion binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005634 nucleus Yes
GO:0043169 cation binding No
GO:0065007 biological regulation No
GO:0010468 regulation of gene expression No
GO:0019222 regulation of metabolic process No
GO:0050794 regulation of cellular process No
GO:0005488 binding No
GO:0046872 metal ion binding No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0051252 regulation of RNA metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0060255 regulation of macromolecule metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:0044424 intracellular part No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050789 regulation of biological process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0044464 cell part No
GO:0031323 regulation of cellular metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003700 DNA-binding transcription factor activity No
GO:0046914 transition metal ion binding No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3647
MCRTRRIKCDETKPTCNQCSKSRRICPGYKDEFDLVFRNETQATERRARKANKKALATKCGHRVDSASSSASSLS
PPSSTDTCTIQAAPQVPLEEQAVCHFISNFVLVPHQGSVRGFMEFLIPLLKGDRVPHHFKYAFDACALASLNNRV
GTGNDFEKEALGKYTKALSATFSALRDPDIAKNDATLASVLLLGLFENITARHVGMLAWGSHIEGAIQLAKARGR
KQLRTKVGLAMFIAVRTQMIIHSLSTSKSPVMGADWWMNDTVRDENASECQRLNIIIGEIRAEANQLLTTSTRSS
DDIERVIAMIKRCQVHDLACVNWAKNLPAYFRWKTVAWEDHVPNGDYTKAEVYPGRVDAYQDLWVVSVWNMMRCS
RIVLASIIVRCAAWISAPVDYRTTPEYATAARTCVDTITDIIASIPYQLGWFSKRNDLLKCANLSTFGCGEEDAQ
KGLGGYFVTWPLACIHGQDYITDSQRTWVQGRLEYIGSQLGVRYAHMLTELNVRVPSMLIRRDGLVSSPYPQPQD
FEKLLSAKMAPPAVGHTLNPLQQREAMQRETIQRQTAELVSKAMGTSGKVDEWTAKTWLQLQHLTPSTRGF*
Coding >Hirsu2|3647
ATGTGCAGAACCCGTCGGATCAAGTGCGATGAAACCAAGCCCACGTGCAACCAGTGCTCCAAGAGCCGGAGAATA
TGTCCAGGCTACAAGGACGAGTTCGACCTCGTTTTCCGCAACGAAACTCAGGCCACGGAAAGAAGGGCGAGGAAG
GCCAATAAAAAGGCTCTGGCAACCAAATGCGGTCATCGCGTCGATTCTGCCTCGAGTTCTGCCTCATCTCTCTCG
CCACCCTCTTCCACCGACACCTGCACTATCCAGGCCGCGCCCCAGGTTCCATTGGAGGAACAAGCGGTTTGCCAC
TTTATCTCCAACTTCGTCCTAGTTCCGCACCAGGGAAGCGTCCGGGGATTCATGGAGTTTCTGATTCCGCTGTTG
AAGGGTGACCGCGTGCCCCATCACTTCAAGTATGCTTTCGACGCCTGCGCTCTCGCTTCGCTTAATAACCGCGTC
GGGACCGGAAACGACTTCGAGAAAGAGGCTCTGGGAAAATACACAAAGGCCCTCTCCGCAACCTTTTCCGCCTTG
CGCGATCCAGACATTGCCAAGAATGACGCCACACTGGCCTCAGTTCTTCTTCTGGGCTTGTTCGAGAATATCACG
GCCAGGCATGTGGGCATGCTGGCCTGGGGCTCCCACATAGAGGGCGCCATCCAATTAGCTAAGGCTAGGGGTCGC
AAACAGTTGCGCACTAAGGTTGGACTGGCCATGTTCATTGCCGTTCGTACCCAGATGATCATACACAGCCTAAGC
ACCTCAAAGTCTCCGGTCATGGGAGCTGATTGGTGGATGAACGACACAGTCAGAGACGAGAACGCTTCCGAGTGC
CAGCGGCTGAATATTATCATAGGAGAAATCCGGGCTGAGGCCAATCAGCTTCTCACCACCTCCACTCGGTCGTCT
GACGATATTGAAAGGGTCATTGCTATGATAAAGAGATGCCAGGTTCACGATCTGGCTTGTGTCAATTGGGCAAAG
AACCTCCCCGCTTACTTCCGCTGGAAGACAGTGGCCTGGGAAGATCACGTCCCGAACGGCGACTATACCAAGGCC
GAAGTCTACCCAGGGCGTGTAGACGCCTACCAAGACCTCTGGGTTGTGAGCGTGTGGAATATGATGCGATGCTCA
CGAATCGTCCTGGCTTCGATTATCGTGCGTTGCGCCGCCTGGATATCAGCTCCTGTGGACTATCGGACGACGCCG
GAATACGCGACGGCCGCACGGACTTGTGTTGATACCATTACCGACATCATTGCCTCAATTCCCTACCAGCTTGGC
TGGTTCTCAAAACGGAATGACCTATTAAAGTGCGCAAACCTCTCCACCTTCGGATGCGGTGAAGAGGATGCCCAG
AAAGGGCTGGGCGGCTATTTCGTGACGTGGCCTTTGGCTTGTATCCATGGACAGGACTACATCACGGATTCCCAG
CGGACCTGGGTGCAGGGTCGTTTAGAATACATCGGGTCTCAGCTGGGTGTTCGATATGCGCACATGCTGACCGAG
TTAAATGTTCGTGTTCCATCCATGCTTATCCGCAGAGACGGATTGGTCTCAAGTCCATACCCTCAACCCCAGGAT
TTTGAAAAGCTGCTTTCGGCCAAAATGGCGCCTCCGGCCGTTGGCCATACGTTGAATCCGTTGCAGCAGCGCGAG
GCAATGCAAAGAGAGACGATTCAACGGCAGACAGCAGAGCTGGTAAGCAAGGCCATGGGGACGTCAGGTAAAGTC
GACGAATGGACGGCGAAGACATGGTTGCAGCTGCAGCACTTGACGCCATCGACGAGAGGCTTCTGA
Transcript >Hirsu2|3647
ATGTGCAGAACCCGTCGGATCAAGTGCGATGAAACCAAGCCCACGTGCAACCAGTGCTCCAAGAGCCGGAGAATA
TGTCCAGGCTACAAGGACGAGTTCGACCTCGTTTTCCGCAACGAAACTCAGGCCACGGAAAGAAGGGCGAGGAAG
GCCAATAAAAAGGCTCTGGCAACCAAATGCGGTCATCGCGTCGATTCTGCCTCGAGTTCTGCCTCATCTCTCTCG
CCACCCTCTTCCACCGACACCTGCACTATCCAGGCCGCGCCCCAGGTTCCATTGGAGGAACAAGCGGTTTGCCAC
TTTATCTCCAACTTCGTCCTAGTTCCGCACCAGGGAAGCGTCCGGGGATTCATGGAGTTTCTGATTCCGCTGTTG
AAGGGTGACCGCGTGCCCCATCACTTCAAGTATGCTTTCGACGCCTGCGCTCTCGCTTCGCTTAATAACCGCGTC
GGGACCGGAAACGACTTCGAGAAAGAGGCTCTGGGAAAATACACAAAGGCCCTCTCCGCAACCTTTTCCGCCTTG
CGCGATCCAGACATTGCCAAGAATGACGCCACACTGGCCTCAGTTCTTCTTCTGGGCTTGTTCGAGAATATCACG
GCCAGGCATGTGGGCATGCTGGCCTGGGGCTCCCACATAGAGGGCGCCATCCAATTAGCTAAGGCTAGGGGTCGC
AAACAGTTGCGCACTAAGGTTGGACTGGCCATGTTCATTGCCGTTCGTACCCAGATGATCATACACAGCCTAAGC
ACCTCAAAGTCTCCGGTCATGGGAGCTGATTGGTGGATGAACGACACAGTCAGAGACGAGAACGCTTCCGAGTGC
CAGCGGCTGAATATTATCATAGGAGAAATCCGGGCTGAGGCCAATCAGCTTCTCACCACCTCCACTCGGTCGTCT
GACGATATTGAAAGGGTCATTGCTATGATAAAGAGATGCCAGGTTCACGATCTGGCTTGTGTCAATTGGGCAAAG
AACCTCCCCGCTTACTTCCGCTGGAAGACAGTGGCCTGGGAAGATCACGTCCCGAACGGCGACTATACCAAGGCC
GAAGTCTACCCAGGGCGTGTAGACGCCTACCAAGACCTCTGGGTTGTGAGCGTGTGGAATATGATGCGATGCTCA
CGAATCGTCCTGGCTTCGATTATCGTGCGTTGCGCCGCCTGGATATCAGCTCCTGTGGACTATCGGACGACGCCG
GAATACGCGACGGCCGCACGGACTTGTGTTGATACCATTACCGACATCATTGCCTCAATTCCCTACCAGCTTGGC
TGGTTCTCAAAACGGAATGACCTATTAAAGTGCGCAAACCTCTCCACCTTCGGATGCGGTGAAGAGGATGCCCAG
AAAGGGCTGGGCGGCTATTTCGTGACGTGGCCTTTGGCTTGTATCCATGGACAGGACTACATCACGGATTCCCAG
CGGACCTGGGTGCAGGGTCGTTTAGAATACATCGGGTCTCAGCTGGGTGTTCGATATGCGCACATGCTGACCGAG
TTAAATGTTCGTGTTCCATCCATGCTTATCCGCAGAGACGGATTGGTCTCAAGTCCATACCCTCAACCCCAGGAT
TTTGAAAAGCTGCTTTCGGCCAAAATGGCGCCTCCGGCCGTTGGCCATACGTTGAATCCGTTGCAGCAGCGCGAG
GCAATGCAAAGAGAGACGATTCAACGGCAGACAGCAGAGCTGGTAAGCAAGGCCATGGGGACGTCAGGTAAAGTC
GACGAATGGACGGCGAAGACATGGTTGCAGCTGCAGCACTTGACGCCATCGACGAGAGGCTTCTGA
Gene >Hirsu2|3647
ATGTGCAGAACCCGTCGGATCAAGGTACGACAACGTGTCCCGACTTCCTCGTCCTCGCGAAACGCGCTTACTGGT
CTTGCCTTTGAAGTGCGATGAAACCAAGCCCACGTGCAACCAGTGCTCCAAGAGCCGGAGAATATGTCCAGGCTA
CAAGGACGAGTTCGACCTCGTTTTCCGCAACGAAACTCAGGCCACGGAAAGAAGGGCGAGGAAGGCCAATAAAAA
GGCTCTGGCAACCAAATGCGGTCATCGCGTCGATTCTGCCTCGAGTTCTGCCTCATCTCTCTCGCCACCCTCTTC
CACCGACACCTGCACTATCCAGGCCGCGCCCCAGGTTCCATTGGAGGAACAAGCGGTTTGCCACTTTATCTCCAA
CTTCGTCCTAGTTCCGCACCAGGGAAGCGTCCGGGGATTCATGGAGTTTCTGATTCCGCTGTTGAAGGGTGACCG
CGTGCCCCATCACTTCAAGTATGCTTTCGACGCCTGCGCTCTCGCTTCGCTTAATAACCGCGTCGGGACCGGAAA
CGACTTCGAGAAAGAGGCTCTGGGAAAATACACAAAGGCCCTCTCCGCAACCTTTTCCGCCTTGCGCGATCCAGA
CATTGCCAAGAATGACGCCACACTGGCCTCAGTTCTTCTTCTGGGCTTGTTCGAGAATATCACGGCCAGGCATGT
GGGCATGCTGGCCTGGGGCTCCCACATAGAGGGCGCCATCCAATTAGCTAAGGCTAGGGGTCGCAAACAGTTGCG
CACTAAGGTTGGACTGGCCATGTTCATTGCCGTTCGTACCCAGATGGTTAGTTTTCCCACAGCAGTTCTTCTGCG
CTCGTCTGGTTGACGTGCATCGGCCTGCCTCTTGTGCCGTCAAAATGAAGCGCTGACAGCTGGCCTGCTCACCTT
GCTACAGATCATACACAGCCTAAGCACCTCAAAGTCTCCGGTCATGGGAGCTGATTGGTGGATGAACGACACAGT
CAGAGACGAGAACGCTTCCGAGTGCCAGCGGCTGAATATTATCATAGGAGAAATCCGGGCTGAGGCCAATCAGCT
TCTCACCACCTCCACTCGGTCGTCTGACGATATTGAAAGGGTCATTGCTATGATAAAGAGATGCCAGGTTCACGA
TCTGGCTTGTGTCAATTGGGCAAAGAACCTCCCCGCTTACTTCCGCTGGAAGACAGTGGCCTGGGAAGATCACGT
CCCGAACGGCGACTATACCAAGGCCGAAGTCTACCCAGGGCGTGTAGACGCCTACCAAGACCTCTGGGTTGTGAG
CGTGTGGAATATGATGCGATGCTCACGAATCGTCCTGGCTTCGATTATCGTGCGTTGCGCCGCCTGGATATCAGC
TCCTGTGGACTATCGGACGACGCCGGAATACGCGACGGCCGCACGGACTTGTGTTGATACCATTACCGACATCAT
TGCCTCAATTCCCTACCAGCTTGGCTGGTTCTCAAAACGGAATGACCTATTAAAGTGCGCAAACCTCTCCACCTT
CGGATGCGGTGAAGAGGATGCCCAGAAAGGGCTGGGCGGCTATTTCGTGACGTGGCCTTTGGCTTGTATCCATGG
ACAGGACTACATCACGGATTCCCAGCGGACCTGGGTGCAGGGTCGTTTAGAATACATCGGGTCTCAGCTGGGTGT
TCGATATGCGCACATGCTGACCGAGGTAAAGCTTTCATCGTTCCTTGTCCCGGGCAACAACTCGAGGTTGAACGT
GGACGATTGTACGCTGACGAAGTCCGCCGCAGTTAAATGTTCGTGTTCCATCCATGCTTATCCGCAGAGACGGAT
TGGTCTCAAGTCCATACCCTCAACCCCAGGATTTTGAAAAGCTGCTTTCGGCCAAAATGGCGCCTCCGGCCGTTG
GCCATACGTTGAATCCGTTGCAGCAGCGCGAGGCAATGCAAAGAGAGACGATTCAACGGCAGACAGCAGAGCTGG
TAAGCAAGGCCATGGGGACGTCAGGTAAAGTCGACGAATGGACGGCGAAGACATGGTTGCAGCTGCAGCACTTGA
CGCCATCGACGAGAGGCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail