Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|364
Gene name
LocationContig_107:22199..26394
Strand+
Gene length (bp)4195
Transcript length (bp)3576
Coding sequence length (bp)3576
Protein length (aa) 1192

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 1.1E-80 155 363
PF02436 PYC_OADA Conserved carboxylase domain 4.3E-69 871 1070
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 1.7E-38 39 150
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 4.0E-30 379 486
PF00682 HMGL-like HMGL-like 3.9E-26 578 846
PF00364 Biotin_lipoyl Biotin-requiring enzyme 1.8E-18 1122 1188
PF13533 Biotin_lipoyl_2 Biotin-lipoyl like 3.3E-05 1121 1152
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 1.7E-09 182 331
PF02222 ATP-grasp ATP-grasp domain 1.9E-07 178 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 3 1191 0.0E+00
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 3 1191 0.0E+00
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 3 1191 0.0E+00
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 21 1190 0.0E+00
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 25 1185 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 3 1191 0.0E+00
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 3 1191 0.0E+00
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 3 1191 0.0E+00
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 21 1190 0.0E+00
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 25 1185 0.0E+00
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 38 1186 0.0E+00
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 30 1185 0.0E+00
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 27 1190 0.0E+00
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 38 1188 0.0E+00
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 39 1188 0.0E+00
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 39 1188 0.0E+00
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 39 1188 0.0E+00
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 39 1188 0.0E+00
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 35 1191 0.0E+00
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 39 488 2.0E-134
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 39 487 6.0E-126
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 39 493 8.0E-126
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 37 487 4.0E-124
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 39 511 1.0E-123
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 39 508 4.0E-121
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 39 497 3.0E-118
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 39 485 2.0E-113
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 39 485 2.0E-112
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 29 487 5.0E-112
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 41 485 2.0E-111
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 39 485 7.0E-111
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 39 486 9.0E-111
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 40 485 9.0E-110
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 39 486 3.0E-109
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 25 485 1.0E-108
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 40 485 1.0E-108
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 39 486 2.0E-108
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 39 486 4.0E-108
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 39 485 5.0E-107
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 39 486 1.0E-104
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 39 486 1.0E-104
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 42 492 9.0E-104
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 42 492 9.0E-104
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 42 492 9.0E-104
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 32 476 1.0E-102
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 41 487 8.0E-101
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 38 492 1.0E-100
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 38 492 4.0E-100
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 41 487 4.0E-100
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 41 487 4.0E-98
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 39 486 2.0E-97
sp|Q58628|PYCB_METJA Pyruvate carboxylase subunit B OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycB PE=1 SV=1 578 1188 2.0E-94
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 39 487 8.0E-92
sp|P13187|DCOA_KLEPN Oxaloacetate decarboxylase alpha chain OS=Klebsiella pneumoniae GN=oadA PE=3 SV=2 578 1188 7.0E-90
sp|Q8XGX8|DCOA_SALTI Oxaloacetate decarboxylase alpha chain OS=Salmonella typhi GN=oadA1 PE=3 SV=3 578 1188 2.0E-89
sp|O27179|PYCB_METTH Pyruvate carboxylase subunit B OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycB PE=1 SV=1 574 1188 4.0E-89
sp|Q03030|DCOA_SALTY Oxaloacetate decarboxylase alpha chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=oadA1 PE=3 SV=2 578 1188 3.0E-88
sp|D3DJ41|2OCL_HYDTT 2-oxoglutarate carboxylase large subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiA PE=1 SV=1 574 1188 6.0E-86
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 42 486 5.0E-83
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 39 486 2.0E-81
sp|Q70AC7|5S_PROFR Methylmalonyl-CoA carboxyltransferase 5S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=1 584 1100 1.0E-67
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 39 486 2.0E-56
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 39 506 2.0E-56
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 39 486 4.0E-56
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 6 487 1.0E-55
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 39 572 1.0E-55
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 39 541 3.0E-55
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 39 572 3.0E-55
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 39 572 6.0E-55
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 39 486 1.0E-54
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 38 486 1.0E-54
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 39 486 1.0E-54
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 39 572 2.0E-54
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 39 539 3.0E-54
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 39 539 3.0E-54
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 39 539 3.0E-54
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 39 539 3.0E-54
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 39 486 7.0E-54
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 39 539 7.0E-54
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 39 572 7.0E-54
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 39 486 2.0E-52
sp|Q8Z9L7|CARB_SALTI Carbamoyl-phosphate synthase large chain OS=Salmonella typhi GN=carB PE=3 SV=3 105 371 2.0E-16
sp|P14846|CARB_SALTY Carbamoyl-phosphate synthase large chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carB PE=3 SV=4 105 371 2.0E-16
sp|P00968|CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) GN=carB PE=1 SV=2 105 371 5.0E-15
sp|P63738|CARB_SHIFL Carbamoyl-phosphate synthase large chain OS=Shigella flexneri GN=carB PE=3 SV=2 105 371 6.0E-15
sp|P63737|CARB_ECO57 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O157:H7 GN=carB PE=3 SV=2 105 371 6.0E-15
sp|Q9KPH9|CARB_VIBCH Carbamoyl-phosphate synthase large chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=carB PE=3 SV=1 130 371 7.0E-15
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 105 371 7.0E-15
sp|Q87SF3|CARB_VIBPA Carbamoyl-phosphate synthase large chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=carB PE=3 SV=1 130 371 8.0E-15
sp|Q8ZIL4|CARB_YERPE Carbamoyl-phosphate synthase large chain OS=Yersinia pestis GN=carB PE=3 SV=3 105 371 2.0E-14
sp|Q7MNU0|CARB_VIBVY Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain YJ016) GN=carB PE=3 SV=1 130 371 3.0E-14
sp|Q8DEM2|CARB_VIBVU Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain CMCP6) GN=carB PE=3 SV=1 130 371 3.0E-14
sp|C5C687|CARB_BEUC1 Carbamoyl-phosphate synthase large chain OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=carB PE=3 SV=1 131 364 4.0E-14
sp|B1I4M8|CARB_DESAP Carbamoyl-phosphate synthase large chain OS=Desulforudis audaxviator (strain MP104C) GN=carB PE=3 SV=1 131 365 7.0E-14
sp|Q9A4D6|CARB_CAUCR Carbamoyl-phosphate synthase large chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=carB PE=3 SV=1 130 366 8.0E-14
sp|P58939|CARB_CORGL Carbamoyl-phosphate synthase large chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carB PE=3 SV=1 131 364 1.0E-13
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 135 376 2.0E-13
sp|Q8FT42|CARB_COREF Carbamoyl-phosphate synthase large chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carB PE=3 SV=1 131 364 4.0E-13
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 130 371 4.0E-13
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 125 377 5.0E-13
sp|Q97FT3|CARB_CLOAB Carbamoyl-phosphate synthase large chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carB PE=3 SV=1 131 369 7.0E-13
sp|Q9PEC1|CARB_XYLFA Carbamoyl-phosphate synthase large chain OS=Xylella fastidiosa (strain 9a5c) GN=carB PE=3 SV=1 130 367 1.0E-12
sp|P58943|CARB_XANCP Carbamoyl-phosphate synthase large chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=carB PE=3 SV=1 130 369 1.0E-12
sp|Q8K9Z7|CARB_BUCAP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carB PE=3 SV=3 105 371 1.0E-12
sp|Q8XZ83|CARB_RALSO Carbamoyl-phosphate synthase large chain OS=Ralstonia solanacearum (strain GMI1000) GN=carB PE=3 SV=1 130 366 2.0E-12
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 40 364 2.0E-12
sp|Q87EB8|CARB_XYLFT Carbamoyl-phosphate synthase large chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=carB PE=3 SV=1 130 367 2.0E-12
sp|Q9CCR2|CARB_MYCLE Carbamoyl-phosphate synthase large chain OS=Mycobacterium leprae (strain TN) GN=carB PE=3 SV=2 131 364 3.0E-12
sp|B9KXM5|CARB_THERP Carbamoyl-phosphate synthase large chain OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=carB PE=3 SV=1 131 365 5.0E-12
sp|P57244|CARB_BUCAI Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=carB PE=3 SV=2 105 371 8.0E-12
sp|Q9ZB63|CARY_GEOSE Carbamoyl-phosphate synthase arginine-specific large chain OS=Geobacillus stearothermophilus GN=carB PE=1 SV=1 135 364 1.0E-11
sp|Q1IPK2|CARB_KORVE Carbamoyl-phosphate synthase large chain OS=Koribacter versatilis (strain Ellin345) GN=carB PE=3 SV=1 131 364 1.0E-11
sp|A5D508|CARB_PELTS Carbamoyl-phosphate synthase large chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=carB PE=3 SV=1 139 365 1.0E-11
sp|Q67Q54|CARB_SYMTH Carbamoyl-phosphate synthase large chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carB PE=3 SV=1 131 370 2.0E-11
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 135 369 2.0E-11
sp|B2GI87|CARB_KOCRD Carbamoyl-phosphate synthase large chain OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=carB PE=3 SV=1 130 364 3.0E-11
sp|P58942|CARB_XANAC Carbamoyl-phosphate synthase large chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=carB PE=3 SV=1 130 369 3.0E-11
sp|Q9KXR6|CARB_STRCO Carbamoyl-phosphate synthase large chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=carB PE=3 SV=1 131 364 4.0E-11
sp|C1FNY3|CARB_CLOBJ Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Kyoto / Type A2) GN=carB PE=3 SV=1 135 364 5.0E-11
sp|A0JX72|CARB_ARTS2 Carbamoyl-phosphate synthase large chain OS=Arthrobacter sp. (strain FB24) GN=carB PE=3 SV=1 130 364 6.0E-11
sp|Q7UJ58|CARB_RHOBA Carbamoyl-phosphate synthase large chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=carB PE=3 SV=1 131 371 7.0E-11
sp|C1CXR4|CARB_DEIDV Carbamoyl-phosphate synthase large chain OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=carB PE=3 SV=1 130 368 8.0E-11
sp|P9WPK3|CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carB PE=1 SV=1 131 364 8.0E-11
sp|P9WPK2|CARB_MYCTO Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carB PE=3 SV=1 131 364 8.0E-11
sp|O27077|CARB_METTH Carbamoyl-phosphate synthase large chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=carB PE=3 SV=2 137 370 9.0E-11
sp|Q88DU6|CARB_PSEPK Carbamoyl-phosphate synthase large chain OS=Pseudomonas putida (strain KT2440) GN=carB PE=3 SV=2 130 371 1.0E-10
sp|B1W463|CARB_STRGG Carbamoyl-phosphate synthase large chain OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=carB PE=3 SV=1 131 364 1.0E-10
sp|A9WSA8|CARB_RENSM Carbamoyl-phosphate synthase large chain OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=carB PE=3 SV=1 130 364 1.0E-10
sp|A7GE89|CARB_CLOBL Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=carB PE=3 SV=1 135 364 1.0E-10
sp|B0K4D7|CARB_THEPX Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter sp. (strain X514) GN=carB PE=3 SV=1 135 364 2.0E-10
sp|C3NH23|CARB_SULIN Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=carB PE=3 SV=1 40 364 2.0E-10
sp|B8H8U5|CARB_ARTCA Carbamoyl-phosphate synthase large chain OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=carB PE=3 SV=1 130 364 2.0E-10
sp|Q9RWK0|CARB_DEIRA Carbamoyl-phosphate synthase large chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=carB PE=3 SV=1 130 368 2.0E-10
sp|P55641|Y4RH_RHISN Uncharacterized protein y4rH OS=Rhizobium sp. (strain NGR234) GN=NGR_a01790 PE=3 SV=1 17 256 2.0E-10
sp|P38100|CARB_PSEAE Carbamoyl-phosphate synthase large chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=carB PE=3 SV=3 105 371 2.0E-10
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 39 364 3.0E-10
sp|A6WCC6|CARB_KINRD Carbamoyl-phosphate synthase large chain OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=carB PE=3 SV=1 131 364 3.0E-10
sp|C4KHM7|CARB_SULIK Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=carB PE=3 SV=1 40 364 3.0E-10
sp|Q1IWM0|CARB_DEIGD Carbamoyl-phosphate synthase large chain OS=Deinococcus geothermalis (strain DSM 11300) GN=carB PE=3 SV=1 130 368 3.0E-10
sp|C3NEM0|CARB_SULIY Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=carB PE=3 SV=1 40 364 3.0E-10
sp|C3MQE3|CARB_SULIL Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=carB PE=3 SV=1 40 364 3.0E-10
sp|C3MW21|CARB_SULIM Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=carB PE=3 SV=1 40 364 3.0E-10
sp|C3N664|CARB_SULIA Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.27) GN=carB PE=3 SV=1 40 364 3.0E-10
sp|Q7U054|CARB_MYCBO Carbamoyl-phosphate synthase large chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carB PE=3 SV=1 131 364 3.0E-10
sp|Q04H29|CARB_OENOB Carbamoyl-phosphate synthase large chain OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=carB PE=3 SV=1 135 364 4.0E-10
sp|Q58776|CARB2_METJA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carB2 PE=3 SV=1 131 364 5.0E-10
sp|Q8F832|CARB_LEPIN Carbamoyl-phosphate synthase large chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=carB PE=3 SV=1 130 369 5.0E-10
sp|Q72NF1|CARB_LEPIC Carbamoyl-phosphate synthase large chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=carB PE=3 SV=1 130 369 5.0E-10
sp|Q87WP4|CARB_PSESM Carbamoyl-phosphate synthase large chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=carB PE=3 SV=1 105 371 6.0E-10
sp|Q6A914|CARB_PROAC Carbamoyl-phosphate synthase large chain OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=carB PE=3 SV=1 131 366 7.0E-10
sp|A1T8H1|CARB_MYCVP Carbamoyl-phosphate synthase large chain OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=carB PE=3 SV=1 131 364 7.0E-10
sp|A1R6Z3|CARB_ARTAT Carbamoyl-phosphate synthase large chain OS=Arthrobacter aurescens (strain TC1) GN=carB PE=3 SV=1 130 364 7.0E-10
sp|Q827Q7|CARB_STRAW Carbamoyl-phosphate synthase large chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=carB PE=3 SV=1 131 364 8.0E-10
sp|B1I4M8|CARB_DESAP Carbamoyl-phosphate synthase large chain OS=Desulforudis audaxviator (strain MP104C) GN=carB PE=3 SV=1 131 364 9.0E-10
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 135 364 1.0E-09
sp|C1F1S6|CARB_ACIC5 Carbamoyl-phosphate synthase large chain OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=carB PE=3 SV=1 131 364 1.0E-09
sp|Q4J8E8|CARB_SULAC Carbamoyl-phosphate synthase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carB PE=3 SV=1 38 364 1.0E-09
sp|P46537|CARB_BACCL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus caldolyticus GN=pyrAB PE=3 SV=1 135 364 2.0E-09
sp|Q1WVA9|CARB_LACS1 Carbamoyl-phosphate synthase large chain OS=Lactobacillus salivarius (strain UCC118) GN=carB PE=3 SV=1 135 364 2.0E-09
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 131 368 2.0E-09
sp|B2A170|CARB_NATTJ Carbamoyl-phosphate synthase large chain OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=carB PE=3 SV=1 178 364 2.0E-09
sp|Q8RBK0|CARB_CALS4 Carbamoyl-phosphate synthase large chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=carB PE=3 SV=1 135 345 2.0E-09
sp|B3WEF5|CARB_LACCB Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain BL23) GN=carB PE=3 SV=1 135 364 2.0E-09
sp|Q038Z2|CARB_LACC3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain ATCC 334) GN=carB PE=3 SV=1 135 364 2.0E-09
sp|B9EXM2|CARB_ORYSJ Carbamoyl-phosphate synthase large chain, chloroplastic OS=Oryza sativa subsp. japonica GN=CARB PE=2 SV=1 139 371 3.0E-09
sp|B1KT07|CARB_CLOBM Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=carB PE=3 SV=1 135 364 3.0E-09
sp|C4L5W3|CARB_EXISA Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=carB PE=3 SV=1 131 366 3.0E-09
sp|Q67Q54|CARB_SYMTH Carbamoyl-phosphate synthase large chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carB PE=3 SV=1 131 364 4.0E-09
sp|B2A170|CARB_NATTJ Carbamoyl-phosphate synthase large chain OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=carB PE=3 SV=1 182 363 4.0E-09
sp|Q59969|CARB_SULSO Carbamoyl-phosphate synthase large chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carB PE=3 SV=1 40 364 4.0E-09
sp|Q8YQL2|CARB_NOSS1 Carbamoyl-phosphate synthase large chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=carB PE=3 SV=1 144 420 4.0E-09
sp|Q8RG86|CARB_FUSNN Carbamoyl-phosphate synthase large chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=carB PE=3 SV=2 131 392 4.0E-09
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 131 364 5.0E-09
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 131 364 5.0E-09
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 131 364 5.0E-09
sp|A4TBY6|CARB_MYCGI Carbamoyl-phosphate synthase large chain OS=Mycobacterium gilvum (strain PYR-GCK) GN=carB PE=3 SV=1 131 364 5.0E-09
sp|O50236|CARB_ZYMMO Carbamoyl-phosphate synthase large chain OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=carB PE=3 SV=2 130 364 5.0E-09
sp|O50302|CARB_GEOSE Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Geobacillus stearothermophilus GN=pyrAB PE=3 SV=1 135 364 6.0E-09
sp|Q03HB0|CARB_PEDPA Carbamoyl-phosphate synthase large chain OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=carB PE=3 SV=1 135 364 6.0E-09
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 137 367 6.0E-09
sp|A5D508|CARB_PELTS Carbamoyl-phosphate synthase large chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=carB PE=3 SV=1 139 364 7.0E-09
sp|Q9K8V7|CARY_BACHD Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=carB PE=3 SV=1 131 367 7.0E-09
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 39 377 8.0E-09
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 131 362 8.0E-09
sp|P96495|CARB_THET2 Carbamoyl-phosphate synthase large chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=carB PE=3 SV=2 130 366 8.0E-09
sp|Q8TUT7|CARB2_METKA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB2 PE=3 SV=1 139 332 8.0E-09
sp|Q5SKN1|CARB_THET8 Carbamoyl-phosphate synthase large chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=carB PE=3 SV=1 130 366 1.0E-08
sp|Q98I87|CARB_RHILO Carbamoyl-phosphate synthase large chain OS=Rhizobium loti (strain MAFF303099) GN=carB PE=3 SV=1 130 361 1.0E-08
sp|B0KBW4|CARB_THEP3 Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=carB PE=3 SV=1 135 345 1.0E-08
sp|B2THH3|CARB_CLOBB Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=carB PE=3 SV=1 135 364 1.0E-08
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus subtilis (strain 168) GN=carB PE=3 SV=4 135 364 2.0E-08
sp|Q09794|PYR1_SCHPO Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura1 PE=1 SV=1 52 358 2.0E-08
sp|Q55756|CARB_SYNY3 Carbamoyl-phosphate synthase large chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=carB PE=3 SV=2 144 371 2.0E-08
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus subtilis (strain 168) GN=carB PE=3 SV=4 57 364 3.0E-08
sp|Q7M8I0|PURT_WOLSU Phosphoribosylglycinamide formyltransferase 2 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=purT PE=3 SV=1 41 332 3.0E-08
sp|Q732I3|CARB_BACC1 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carB PE=3 SV=1 131 365 3.0E-08
sp|A9VTC6|CARB_BACWK Carbamoyl-phosphate synthase large chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=carB PE=3 SV=1 131 365 3.0E-08
sp|O67233|CARB2_AQUAE Carbamoyl-phosphate synthase large chain, C-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB2 PE=3 SV=1 130 364 4.0E-08
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 135 364 4.0E-08
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 135 364 4.0E-08
sp|C5CCF1|CARB_MICLC Carbamoyl-phosphate synthase large chain OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=carB PE=3 SV=1 130 364 5.0E-08
sp|Q8EYF0|PURT_LEPIN Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=purT PE=3 SV=1 40 332 5.0E-08
sp|Q72LY0|PURT_LEPIC Phosphoribosylglycinamide formyltransferase 2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=purT PE=3 SV=1 40 332 5.0E-08
sp|P58944|CARB_METMA Carbamoyl-phosphate synthase large chain OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=carB PE=3 SV=1 121 364 6.0E-08
sp|P58941|CARB_STRP8 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=carB PE=3 SV=1 131 365 6.0E-08
sp|Q5XCR6|CARB_STRP6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=carB PE=3 SV=2 131 365 6.0E-08
sp|A2RF60|CARB_STRPG Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=carB PE=3 SV=1 131 365 6.0E-08
sp|Q03WW7|CARB_LEUMM Carbamoyl-phosphate synthase large chain OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=carB PE=3 SV=1 181 364 6.0E-08
sp|Q9A0C6|CARB_STRP1 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M1 GN=carB PE=3 SV=1 131 365 6.0E-08
sp|Q1AVY9|CARB_RUBXD Carbamoyl-phosphate synthase large chain OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=carB PE=3 SV=1 183 364 7.0E-08
sp|Q8RBK0|CARB_CALS4 Carbamoyl-phosphate synthase large chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=carB PE=3 SV=1 114 365 9.0E-08
sp|P25994|CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) GN=pyrAB PE=3 SV=1 171 364 9.0E-08
sp|B9IVW3|CARB_BACCQ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain Q1) GN=carB PE=3 SV=1 131 365 9.0E-08
sp|B7HLM0|CARB_BACC7 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH187) GN=carB PE=3 SV=1 131 365 9.0E-08
sp|B9DPN2|CARB_STACT Carbamoyl-phosphate synthase large chain OS=Staphylococcus carnosus (strain TM300) GN=carB PE=3 SV=1 135 364 1.0E-07
sp|Q03LT8|CARB_STRTD Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=carB PE=3 SV=1 131 364 1.0E-07
sp|Q5M5F6|CARB_STRT2 Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=carB PE=3 SV=1 131 364 1.0E-07
sp|Q5M0W9|CARB_STRT1 Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain CNRZ 1066) GN=carB PE=3 SV=1 131 364 1.0E-07
sp|A5UKG5|CARB_METS3 Carbamoyl-phosphate synthase large chain OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=carB PE=3 SV=1 138 369 1.0E-07
sp|Q6HES8|CARB_BACHK Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|O67869|CARB1_AQUAE Carbamoyl-phosphate synthase large chain, N-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB1 PE=3 SV=1 135 364 1.0E-07
sp|B7H6M2|CARB_BACC4 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain B4264) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|C1EPQ0|CARB_BACC3 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain 03BB102) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|A0RHQ8|CARB_BACAH Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis (strain Al Hakam) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|P59448|CARB_BUCBP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=carB PE=3 SV=1 105 361 1.0E-07
sp|Q819S3|CARB_BACCR Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|B8DTW3|CARB_BIFA0 Carbamoyl-phosphate synthase large chain OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=carB PE=3 SV=1 131 363 1.0E-07
sp|Q0SPY4|CARB_CLOPS Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain SM101 / Type A) GN=carB PE=3 SV=1 135 364 1.0E-07
sp|B7JJX3|CARB_BACC0 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH820) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|Q636E0|CARB_BACCZ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ZK / E33L) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|Q81WF2|CARB_BACAN Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis GN=carB PE=3 SV=1 131 365 1.0E-07
sp|C3L740|CARB_BACAC Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|C3P656|CARB_BACAA Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain A0248) GN=carB PE=3 SV=1 131 365 1.0E-07
sp|Q8Z9L7|CARB_SALTI Carbamoyl-phosphate synthase large chain OS=Salmonella typhi GN=carB PE=3 SV=3 135 364 2.0E-07
sp|P14846|CARB_SALTY Carbamoyl-phosphate synthase large chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carB PE=3 SV=4 135 364 2.0E-07
sp|Q97FT3|CARB_CLOAB Carbamoyl-phosphate synthase large chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carB PE=3 SV=1 123 364 2.0E-07
sp|P46537|CARB_BACCL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus caldolyticus GN=pyrAB PE=3 SV=1 131 365 2.0E-07
sp|Q03HB0|CARB_PEDPA Carbamoyl-phosphate synthase large chain OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=carB PE=3 SV=1 131 366 2.0E-07
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 131 368 2.0E-07
sp|B0REV9|CARB_CLAMS Carbamoyl-phosphate synthase large chain OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=carB PE=3 SV=1 131 370 2.0E-07
sp|C1KWD4|CARB_LISMC Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=carB PE=3 SV=1 131 367 2.0E-07
sp|Q5LD90|PURT_BACFN Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=purT PE=3 SV=1 39 401 2.0E-07
sp|Q4L574|PURK_STAHJ N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purK PE=3 SV=2 148 332 2.0E-07
sp|Q42601|CARB_ARATH Carbamoyl-phosphate synthase large chain, chloroplastic OS=Arabidopsis thaliana GN=CARB PE=1 SV=1 144 371 2.0E-07
sp|Q9CFV2|CARB_LACLA Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=carB PE=3 SV=1 131 368 2.0E-07
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 135 364 2.0E-07
sp|B7IUP6|CARB_BACC2 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain G9842) GN=carB PE=3 SV=1 131 365 2.0E-07
sp|Q8ZY48|CARB_PYRAE Carbamoyl-phosphate synthase large chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=carB PE=3 SV=1 37 364 2.0E-07
sp|O93937|PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrABCN PE=3 SV=2 142 363 2.0E-07
sp|Q7VP67|CARB_HAEDU Carbamoyl-phosphate synthase large chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=carB PE=3 SV=1 130 371 2.0E-07
sp|B1IC65|CARB_STRPI Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=carB PE=3 SV=1 125 364 2.0E-07
sp|Q38X24|CARB_LACSS Carbamoyl-phosphate synthase large chain OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=carB PE=3 SV=1 172 364 2.0E-07
sp|A0AJU0|CARB_LISW6 Carbamoyl-phosphate synthase large chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=carB PE=3 SV=1 131 367 2.0E-07
sp|B9KXM5|CARB_THERP Carbamoyl-phosphate synthase large chain OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=carB PE=3 SV=1 135 364 3.0E-07
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 183 451 3.0E-07
sp|C4L5W3|CARB_EXISA Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=carB PE=3 SV=1 171 364 3.0E-07
sp|A9VTC6|CARB_BACWK Carbamoyl-phosphate synthase large chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=carB PE=3 SV=1 125 364 3.0E-07
sp|P0DA14|CARB_STRP3 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=carB PE=3 SV=1 131 365 3.0E-07
sp|B2IQ67|CARB_STRPS Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain CGSP14) GN=carB PE=3 SV=1 106 364 3.0E-07
sp|B8ZJT9|CARB_STRPJ Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=carB PE=3 SV=1 106 364 3.0E-07
sp|C1CR31|CARB_STRZT Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=carB PE=3 SV=1 106 364 3.0E-07
sp|Q97QE4|CARB_STRPN Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=carB PE=3 SV=1 106 364 3.0E-07
sp|Q04K48|CARB_STRP2 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=carB PE=3 SV=1 106 364 3.0E-07
sp|C1C7Q3|CARB_STRP7 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain 70585) GN=carB PE=3 SV=1 106 364 3.0E-07
sp|Q9K9V9|CARB_BACHD Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAB PE=3 SV=1 131 365 3.0E-07
sp|Q9K9V9|CARB_BACHD Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAB PE=3 SV=1 171 364 3.0E-07
sp|P05115|BCCP_SOLLC Biotin carboxyl carrier protein of acetyl-CoA carboxylase (Fragment) OS=Solanum lycopersicum PE=2 SV=1 1125 1184 3.0E-07
sp|Q9CKV0|CARB_PASMU Carbamoyl-phosphate synthase large chain OS=Pasteurella multocida (strain Pm70) GN=carB PE=3 SV=1 105 371 3.0E-07
sp|Q49WY4|CARB_STAS1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carB PE=3 SV=1 135 364 3.0E-07
sp|Q8CWR0|CARB_STRR6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=carB PE=3 SV=1 106 364 3.0E-07
sp|Q8ZW35|LEU1_PYRAE Probable 2-isopropylmalate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuA PE=3 SV=1 676 829 3.0E-07
sp|C1EPQ0|CARB_BACC3 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain 03BB102) GN=carB PE=3 SV=1 125 364 4.0E-07
sp|A0RHQ8|CARB_BACAH Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis (strain Al Hakam) GN=carB PE=3 SV=1 125 364 4.0E-07
sp|B7IUP6|CARB_BACC2 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain G9842) GN=carB PE=3 SV=1 125 364 4.0E-07
sp|Q0TM79|CARB_CLOP1 Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=carB PE=3 SV=1 135 364 4.0E-07
sp|Q8XHB3|CARB_CLOPE Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain 13 / Type A) GN=carB PE=3 SV=1 135 364 4.0E-07
sp|Q834E2|CARB_ENTFA Carbamoyl-phosphate synthase large chain OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=carB PE=3 SV=1 131 365 4.0E-07
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 135 364 5.0E-07
sp|Q732I3|CARB_BACC1 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carB PE=3 SV=1 125 364 5.0E-07
sp|Q03WW7|CARB_LEUMM Carbamoyl-phosphate synthase large chain OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=carB PE=3 SV=1 192 366 5.0E-07
sp|B7JJX3|CARB_BACC0 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH820) GN=carB PE=3 SV=1 125 364 5.0E-07
sp|Q81WF2|CARB_BACAN Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis GN=carB PE=3 SV=1 125 364 5.0E-07
sp|C3L740|CARB_BACAC Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=carB PE=3 SV=1 125 364 5.0E-07
sp|C3P656|CARB_BACAA Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain A0248) GN=carB PE=3 SV=1 125 364 5.0E-07
sp|Q7A695|PURK_STAAN N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain N315) GN=purK PE=1 SV=1 148 332 5.0E-07
sp|Q99V32|PURK_STAAM N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purK PE=3 SV=1 148 332 5.0E-07
sp|Q71YI1|CARB_LISMF Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carB PE=3 SV=1 131 367 5.0E-07
sp|Q8NX94|PURK_STAAW N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MW2) GN=purK PE=3 SV=1 148 332 5.0E-07
sp|Q6GAE8|PURK_STAAS N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MSSA476) GN=purK PE=3 SV=1 148 332 5.0E-07
sp|B8DDR7|CARB_LISMH Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=carB PE=3 SV=1 131 367 5.0E-07
sp|Q5HH19|PURK_STAAC N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain COL) GN=purK PE=3 SV=1 148 332 5.0E-07
sp|Q8CPJ4|CARB_STAES Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carB PE=3 SV=1 135 364 5.0E-07
sp|Q8DUP3|CARB_STRMU Carbamoyl-phosphate synthase large chain OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=carB PE=3 SV=1 178 364 5.0E-07
sp|Q5HPY8|CARB_STAEQ Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carB PE=3 SV=1 135 364 5.0E-07
sp|B1YIR9|CARB_EXIS2 Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=carB PE=3 SV=1 139 377 5.0E-07
sp|Q87WP4|CARB_PSESM Carbamoyl-phosphate synthase large chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=carB PE=3 SV=1 135 364 6.0E-07
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 189 369 6.0E-07
sp|Q38X24|CARB_LACSS Carbamoyl-phosphate synthase large chain OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=carB PE=3 SV=1 131 364 6.0E-07
sp|Q74J34|CARB_LACJO Carbamoyl-phosphate synthase large chain OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=carB PE=3 SV=1 142 364 6.0E-07
sp|P77886|CARB_LACPL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrAB PE=3 SV=2 131 364 6.0E-07
sp|B0KBW4|CARB_THEP3 Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=carB PE=3 SV=1 182 365 7.0E-07
sp|B9IVW3|CARB_BACCQ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain Q1) GN=carB PE=3 SV=1 125 364 7.0E-07
sp|B7HLM0|CARB_BACC7 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH187) GN=carB PE=3 SV=1 125 364 7.0E-07
sp|Q636E0|CARB_BACCZ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ZK / E33L) GN=carB PE=3 SV=1 125 364 7.0E-07
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 1108 1184 8.0E-07
sp|P00968|CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) GN=carB PE=1 SV=2 135 364 8.0E-07
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 105 364 8.0E-07
sp|C1CEM9|CARB_STRZJ Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain JJA) GN=carB PE=3 SV=1 125 364 8.0E-07
sp|P63738|CARB_SHIFL Carbamoyl-phosphate synthase large chain OS=Shigella flexneri GN=carB PE=3 SV=2 135 364 9.0E-07
sp|P63737|CARB_ECO57 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O157:H7 GN=carB PE=3 SV=2 135 364 9.0E-07
sp|Q8ZIL4|CARB_YERPE Carbamoyl-phosphate synthase large chain OS=Yersinia pestis GN=carB PE=3 SV=3 139 364 9.0E-07
sp|Q6HES8|CARB_BACHK Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carB PE=3 SV=1 125 364 9.0E-07
sp|Q02YG5|CARB_LACLS Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=carB PE=3 SV=1 131 365 9.0E-07
sp|Q5HQA5|PURK_STAEQ N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=purK PE=3 SV=1 148 332 9.0E-07
sp|Q8CPP2|PURK_STAES N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=purK PE=3 SV=1 148 332 9.0E-07
sp|A9KI94|CARB_CLOPH Carbamoyl-phosphate synthase large chain OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=carB PE=3 SV=1 137 365 9.0E-07
sp|P0DA15|CARB_STRPQ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=carB PE=3 SV=1 131 365 9.0E-07
sp|P02904|BCCP_PROFR Methylmalonyl-CoA carboxyltransferase 1.3S subunit OS=Propionibacterium freudenreichii subsp. shermanii PE=1 SV=1 1125 1188 9.0E-07
sp|C0M756|CARB_STRE4 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. equi (strain 4047) GN=carB PE=3 SV=1 131 365 9.0E-07
sp|A5CRX5|CARB_CLAM3 Carbamoyl-phosphate synthase large chain OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=carB PE=3 SV=1 131 370 9.0E-07
sp|O32771|CARB_LACLM Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=carB PE=2 SV=2 131 365 9.0E-07
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 1125 1184 1.0E-06
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 131 362 1.0E-06
sp|Q8XZ83|CARB_RALSO Carbamoyl-phosphate synthase large chain OS=Ralstonia solanacearum (strain GMI1000) GN=carB PE=3 SV=1 135 364 1.0E-06
sp|B0K4D7|CARB_THEPX Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter sp. (strain X514) GN=carB PE=3 SV=1 137 365 1.0E-06
sp|A1T8H1|CARB_MYCVP Carbamoyl-phosphate synthase large chain OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=carB PE=3 SV=1 125 364 1.0E-06
sp|O50302|CARB_GEOSE Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Geobacillus stearothermophilus GN=pyrAB PE=3 SV=1 131 365 1.0E-06
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 130 369 1.0E-06
sp|Q5HPY8|CARB_STAEQ Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carB PE=3 SV=1 131 368 1.0E-06
sp|A9KI94|CARB_CLOPH Carbamoyl-phosphate synthase large chain OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=carB PE=3 SV=1 187 364 1.0E-06
sp|B5E512|CARB_STRP4 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=carB PE=3 SV=1 125 364 1.0E-06
sp|A5GPT7|PURT_SYNPW Phosphoribosylglycinamide formyltransferase 2 OS=Synechococcus sp. (strain WH7803) GN=purT PE=3 SV=1 41 332 1.0E-06
sp|A8YVZ3|CARB_LACH4 Carbamoyl-phosphate synthase large chain OS=Lactobacillus helveticus (strain DPC 4571) GN=carB PE=3 SV=1 142 364 1.0E-06
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 105 364 1.0E-06
sp|B1HQC1|CARB_LYSSC Carbamoyl-phosphate synthase large chain OS=Lysinibacillus sphaericus (strain C3-41) GN=carB PE=3 SV=1 139 365 1.0E-06
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 105 364 1.0E-06
sp|Q8RSS3|CARB_HALER Carbamoyl-phosphate synthase large chain OS=Halomonas eurihalina GN=carB PE=3 SV=1 130 369 1.0E-06
sp|Q9RLS9|CARY_LACPL Carbamoyl-phosphate synthase arginine-specific large chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=carB PE=2 SV=3 130 364 1.0E-06
sp|A7GRL1|CARB_BACCN Carbamoyl-phosphate synthase large chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=carB PE=3 SV=1 131 365 1.0E-06
sp|Q92AH3|CARB_LISIN Carbamoyl-phosphate synthase large chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carB PE=3 SV=1 131 367 1.0E-06
sp|B5XKW2|CARB_STRPZ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=carB PE=3 SV=1 131 365 1.0E-06
sp|Q88DU6|CARB_PSEPK Carbamoyl-phosphate synthase large chain OS=Pseudomonas putida (strain KT2440) GN=carB PE=3 SV=2 135 364 2.0E-06
sp|B3WEF5|CARB_LACCB Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain BL23) GN=carB PE=3 SV=1 186 376 2.0E-06
sp|Q038Z2|CARB_LACC3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain ATCC 334) GN=carB PE=3 SV=1 186 376 2.0E-06
sp|P58941|CARB_STRP8 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=carB PE=3 SV=1 131 364 2.0E-06
sp|Q5XCR6|CARB_STRP6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=carB PE=3 SV=2 131 364 2.0E-06
sp|Q9A0C6|CARB_STRP1 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M1 GN=carB PE=3 SV=1 131 364 2.0E-06
sp|B7H6M2|CARB_BACC4 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain B4264) GN=carB PE=3 SV=1 125 364 2.0E-06
sp|Q819S3|CARB_BACCR Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carB PE=3 SV=1 125 364 2.0E-06
sp|B8DTW3|CARB_BIFA0 Carbamoyl-phosphate synthase large chain OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=carB PE=3 SV=1 135 393 2.0E-06
sp|P0DA14|CARB_STRP3 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=carB PE=3 SV=1 131 364 2.0E-06
sp|Q8CPJ4|CARB_STAES Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carB PE=3 SV=1 131 368 2.0E-06
sp|B1YIR9|CARB_EXIS2 Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=carB PE=3 SV=1 131 367 2.0E-06
sp|P0DA15|CARB_STRPQ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=carB PE=3 SV=1 131 364 2.0E-06
sp|C0M756|CARB_STRE4 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. equi (strain 4047) GN=carB PE=3 SV=1 131 364 2.0E-06
sp|B5XKW2|CARB_STRPZ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=carB PE=3 SV=1 131 364 2.0E-06
sp|Q6GI19|PURK_STAAR N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus aureus (strain MRSA252) GN=purK PE=3 SV=1 148 332 2.0E-06
sp|C0MEH1|CARB_STRS7 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=carB PE=3 SV=1 131 364 2.0E-06
sp|Q8UDE9|CARB_AGRFC Carbamoyl-phosphate synthase large chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=carB PE=3 SV=2 130 361 2.0E-06
sp|B1MZ74|CARB_LEUCK Carbamoyl-phosphate synthase large chain OS=Leuconostoc citreum (strain KM20) GN=carB PE=3 SV=1 192 366 2.0E-06
sp|A7Z0Z2|PURT_BACMF Phosphoribosylglycinamide formyltransferase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purT PE=3 SV=1 36 332 2.0E-06
sp|Q047M8|CARB_LACDB Carbamoyl-phosphate synthase large chain OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=carB PE=3 SV=1 150 364 2.0E-06
sp|Q8G815|CARB_BIFLO Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum (strain NCC 2705) GN=carB PE=3 SV=1 131 362 2.0E-06
sp|B3DQ32|CARB_BIFLD Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum (strain DJO10A) GN=carB PE=3 SV=1 131 362 2.0E-06
sp|P39771|PURT_BACSU Phosphoribosylglycinamide formyltransferase 2 OS=Bacillus subtilis (strain 168) GN=purT PE=3 SV=2 36 332 2.0E-06
sp|Q748D8|DDL_GEOSL D-alanine--D-alanine ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ddl PE=3 SV=1 155 330 2.0E-06
sp|Q8Y665|CARB_LISMO Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carB PE=3 SV=1 131 367 2.0E-06
sp|Q469Z7|CARB_METBF Carbamoyl-phosphate synthase large chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=carB PE=3 SV=1 121 364 2.0E-06
sp|B9KB91|CARB_THENN Carbamoyl-phosphate synthase large chain OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=carB PE=3 SV=1 131 364 2.0E-06
sp|A2RF60|CARB_STRPG Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=carB PE=3 SV=1 131 364 3.0E-06
sp|Q8Y665|CARB_LISMO Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carB PE=3 SV=1 155 364 3.0E-06
sp|Q8TWX0|CARB1_METKA Carbamoyl-phosphate synthase large chain, N-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB1 PE=3 SV=1 143 345 3.0E-06
sp|Q9PLG1|MUDD_CHLMU Bifunctional enzyme MurC/Ddl OS=Chlamydia muridarum (strain MoPn / Nigg) GN=murC/ddl PE=3 SV=2 117 331 3.0E-06
sp|B2G564|CARB_LACRJ Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain JCM 1112) GN=carB PE=3 SV=1 135 364 3.0E-06
sp|A5VHN6|CARB_LACRD Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain DSM 20016) GN=carB PE=3 SV=1 135 364 3.0E-06
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 135 364 4.0E-06
sp|O27077|CARB_METTH Carbamoyl-phosphate synthase large chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=carB PE=3 SV=2 192 393 4.0E-06
sp|Q8YQL2|CARB_NOSS1 Carbamoyl-phosphate synthase large chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=carB PE=3 SV=1 155 364 4.0E-06
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 173 364 4.0E-06
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 173 364 4.0E-06
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 173 364 4.0E-06
sp|B2THH3|CARB_CLOBB Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=carB PE=3 SV=1 189 369 4.0E-06
sp|P25994|CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) GN=pyrAB PE=3 SV=1 131 368 4.0E-06
sp|A5UKG5|CARB_METS3 Carbamoyl-phosphate synthase large chain OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=carB PE=3 SV=1 177 393 4.0E-06
sp|A7GRL1|CARB_BACCN Carbamoyl-phosphate synthase large chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=carB PE=3 SV=1 125 364 4.0E-06
sp|Q8TNY4|CARB_METAC Carbamoyl-phosphate synthase large chain OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=carB PE=3 SV=1 121 364 4.0E-06
sp|Q8E5F5|CARB_STRA3 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype III (strain NEM316) GN=carB PE=3 SV=1 135 364 4.0E-06
sp|Q3K150|CARB_STRA1 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=carB PE=3 SV=1 135 364 4.0E-06
sp|C1CL09|CARB_STRZP Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain P1031) GN=carB PE=3 SV=1 171 364 4.0E-06
sp|O94313|CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg4 PE=3 SV=1 55 376 4.0E-06
sp|B1VRH5|HOA_STRGG 4-hydroxy-2-oxovalerate aldolase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=SGR_564 PE=3 SV=1 667 839 4.0E-06
sp|Q8DZQ7|CARB_STRA5 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=carB PE=3 SV=1 135 364 4.0E-06
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 1097 1188 5.0E-06
sp|C3NH23|CARB_SULIN Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=carB PE=3 SV=1 132 369 5.0E-06
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 131 350 5.0E-06
sp|C4KHM7|CARB_SULIK Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=carB PE=3 SV=1 132 369 5.0E-06
sp|Q55756|CARB_SYNY3 Carbamoyl-phosphate synthase large chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=carB PE=3 SV=2 135 364 5.0E-06
sp|A8ACE0|PURT_IGNH4 Phosphoribosylglycinamide formyltransferase 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=purT PE=3 SV=1 40 332 5.0E-06
sp|Q8A9W1|PURT_BACTN Phosphoribosylglycinamide formyltransferase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=purT PE=3 SV=1 39 387 5.0E-06
sp|Q49WI9|PURK_STAS1 N5-carboxyaminoimidazole ribonucleotide synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=purK PE=3 SV=1 148 332 5.0E-06
sp|Q9PIL7|CARB_CAMJE Carbamoyl-phosphate synthase large chain OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=carB PE=3 SV=1 132 364 5.0E-06
sp|C3NEM0|CARB_SULIY Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=carB PE=3 SV=1 132 369 6.0E-06
sp|C3MQE3|CARB_SULIL Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=carB PE=3 SV=1 132 369 6.0E-06
sp|C3MW21|CARB_SULIM Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=carB PE=3 SV=1 132 369 6.0E-06
sp|C3N664|CARB_SULIA Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.27) GN=carB PE=3 SV=1 132 369 6.0E-06
sp|Q0SPY4|CARB_CLOPS Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain SM101 / Type A) GN=carB PE=3 SV=1 190 365 6.0E-06
sp|A0AJU0|CARB_LISW6 Carbamoyl-phosphate synthase large chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=carB PE=3 SV=1 155 364 6.0E-06
sp|Q8XHB3|CARB_CLOPE Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain 13 / Type A) GN=carB PE=3 SV=1 190 365 6.0E-06
sp|Q0TM79|CARB_CLOP1 Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=carB PE=3 SV=1 190 365 7.0E-06
sp|C0MEH1|CARB_STRS7 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=carB PE=3 SV=1 131 365 7.0E-06
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 135 355 7.0E-06
sp|C1KWD4|CARB_LISMC Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=carB PE=3 SV=1 155 364 8.0E-06
sp|B8DDR7|CARB_LISMH Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=carB PE=3 SV=1 155 364 8.0E-06
sp|Q3K150|CARB_STRA1 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=carB PE=3 SV=1 131 364 8.0E-06
sp|Q8DZQ7|CARB_STRA5 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=carB PE=3 SV=1 131 364 8.0E-06
sp|Q6GHN2|CARB_STAAR Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MRSA252) GN=carB PE=3 SV=1 142 364 8.0E-06
sp|A3CNI5|CARB_STRSV Carbamoyl-phosphate synthase large chain OS=Streptococcus sanguinis (strain SK36) GN=carB PE=3 SV=1 150 364 8.0E-06
sp|Q2YXG5|CARB_STAAB Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=carB PE=3 SV=1 155 364 8.0E-06
sp|A1ANT6|PURT_PELPD Phosphoribosylglycinamide formyltransferase 2 OS=Pelobacter propionicus (strain DSM 2379) GN=purT PE=3 SV=1 41 332 8.0E-06
sp|P63740|CARB_STAAN Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain N315) GN=carB PE=1 SV=1 155 364 8.0E-06
sp|P63739|CARB_STAAM Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carB PE=3 SV=1 155 364 8.0E-06
sp|A5IS88|CARB_STAA9 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH9) GN=carB PE=3 SV=1 155 364 8.0E-06
sp|A6U122|CARB_STAA2 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH1) GN=carB PE=3 SV=1 155 364 8.0E-06
sp|A7X1F4|CARB_STAA1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=carB PE=3 SV=1 155 364 8.0E-06
sp|Q71YI1|CARB_LISMF Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|Q8RSS3|CARB_HALER Carbamoyl-phosphate synthase large chain OS=Halomonas eurihalina GN=carB PE=3 SV=1 181 364 9.0E-06
sp|Q92AH3|CARB_LISIN Carbamoyl-phosphate synthase large chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|Q8E5F5|CARB_STRA3 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype III (strain NEM316) GN=carB PE=3 SV=1 131 364 9.0E-06
sp|A8Z3P0|CARB_STAAT Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|Q6GA10|CARB_STAAS Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MSSA476) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|A6QGA4|CARB_STAAE Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Newman) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|Q5HGM9|CARB_STAAC Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain COL) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|Q2FZ72|CARB_STAA8 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain NCTC 8325) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|Q2FHN5|CARB_STAA3 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300) GN=carB PE=3 SV=1 155 364 9.0E-06
sp|Q91293|CPSM_LITCT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Lithobates catesbeiana PE=2 SV=1 169 465 9.0E-06
sp|Q97AJ3|CARB_THEVO Carbamoyl-phosphate synthase large chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=carB PE=3 SV=1 193 364 9.0E-06
sp|A2SQ53|CARB_METLZ Carbamoyl-phosphate synthase large chain OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=carB PE=3 SV=1 69 372 9.0E-06
sp|Q8FZJ3|CARB_BRUSU Carbamoyl-phosphate synthase large chain OS=Brucella suis biovar 1 (strain 1330) GN=carB PE=3 SV=1 130 361 9.0E-06
sp|Q5FJC0|CARB_LACAC Carbamoyl-phosphate synthase large chain OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=carB PE=3 SV=1 142 364 9.0E-06
sp|P58940|CARB_STAAW Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MW2) GN=carB PE=3 SV=1 142 364 9.0E-06
sp|Q9K8V7|CARY_BACHD Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=carB PE=3 SV=1 131 364 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0003824 catalytic activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0016874 ligase activity No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0016881 acid-amino acid ligase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|364
MAMAAPQQTLSFNDVFEDDDVDEPKSVHHIRANSSIMQLKKILVANRGEIPIRIFRTAHELSLHTIAVFSYEDRL
SMHRQKADEAYVIGKRGQYTPVGAYLAGDEIIRIAVEHGAQLIHPGYGFLSENAEFARNVEKAGLIFVGPSPEVI
DSLGDKVSARKLAIAAGVPVVPGTEGAVARFEEVKAFTDKYGFPIIIKAAYGGGGRGMRVVREPESLKEHFERAT
SEAKSAFGNGTVFVERFLDKPKHIEVQLLGDNHGNIVHLYERDCSVQRRHQKVVEIAPAKDLPAETRDAILADAV
KLAKSVNYRNAGTAEFLVDQQNRYYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGATLSQLGLTQDRISTRG
FAIQCRITTEDPAKQFQPDTGKIEVYRSAGGNGVRLDGGNGFAGAVITPFYDSMLVKCTCQGSTYEIARRKVLRA
LIEFRVRGVKTNIPFLVSLLTHPTFIDGTCWTTFIDDTPQLFDLVGSQNRAQKLLAYLGDVAVNGSSIKGQIGEP
KFRGELVPPQLLASDGHKVDVSEPCRKGWRNILVEQGPKAFAKAVRQYKGCLLMDTTWRDAHQSLLATRVRTVDL
LNIAKETSHALSNLYSLECWGGATFDVAMRFLYEDPWDRLRRMRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHF
VDQAKKNGVDIFRVFDALNDIDQLEVGIKAVHKAGGVAEGTVCYSGDMLSPGKKYNLEYYMDLVDKLVKLDIHVL
GIKDMAGVLKPHAATLLIGSIRKKYPDLPIHVHTHDSAGTGVASMVACAKAGADAVDAATDSLSGMTSQPSINAI
IASLEGSDLDPGLDPKQVRALDVYWSQLRLLYSPFEAHLAGPDPEVYEHEIPGGQLTNMMFQASQLGLGSQWLET
KKAYEHANDLLGDIVKVTPTSKVVGDLAQFMVSNKLSAEDVKARASELDFPGSVLEFLEGLMGQPYGGFPEPLRS
NALRGRRKLDKRPGLFLDPVDFSKAKKEIAKKFGGPVTECDIASYVMYPKVFEDYKKFVQQYGDLSVLPTKYFLS
RPEIGEEFNVELEKGKVLILKLLAVGPLSENTGQREVFFEMNGEVRQVTVMDKQAAVENISRPKADPGDSSQVGA
PMSGVLVEMRVHEGSDVKKGDPLAVLSAMKMEMVISAPHSGKVASLQVKEGDSVDGSDLVCRITKG*
Coding >Hirsu2|364
ATGGCGATGGCGGCCCCTCAACAGACTCTGAGCTTCAACGATGTTTTCGAAGACGATGATGTCGACGAGCCCAAG
TCGGTCCACCACATCCGCGCCAACTCGAGCATCATGCAGCTTAAAAAGATCCTTGTTGCCAATCGTGGTGAAATC
CCCATTCGGATTTTCAGGACTGCCCATGAACTATCTCTGCACACTATTGCCGTCTTCAGTTATGAGGACCGTCTG
AGCATGCATCGGCAAAAGGCTGACGAGGCCTACGTCATCGGCAAGCGTGGCCAGTATACCCCTGTCGGAGCTTAT
CTCGCCGGCGACGAGATCATCAGAATTGCCGTCGAGCACGGCGCCCAACTGATCCACCCAGGCTACGGCTTCCTC
TCTGAAAACGCCGAGTTTGCCCGCAATGTCGAAAAGGCCGGCCTCATTTTTGTTGGCCCCAGTCCCGAAGTCATC
GACTCCTTGGGCGACAAGGTTTCCGCCCGTAAGTTGGCCATTGCGGCTGGTGTCCCCGTCGTGCCCGGTACCGAG
GGTGCCGTTGCCAGGTTTGAGGAGGTCAAGGCCTTCACCGACAAGTATGGCTTCCCCATCATCATCAAGGCCGCC
TACGGTGGCGGCGGCCGCGGCATGCGCGTCGTCCGCGAGCCGGAGAGCTTGAAGGAGCACTTCGAGAGAGCCACG
TCCGAGGCCAAGTCCGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGCTTCCTCGACAAGCCCAAGCACATCGAG
GTGCAGCTCCTCGGCGACAACCACGGCAACATCGTCCACCTGTACGAGCGAGACTGTTCCGTCCAGCGCCGCCAC
CAAAAGGTTGTCGAGATCGCTCCGGCCAAAGACCTCCCGGCCGAGACGAGAGATGCCATCCTGGCAGACGCCGTC
AAGCTGGCCAAGTCGGTCAACTACCGCAATGCGGGCACCGCCGAGTTCCTCGTCGACCAGCAGAACCGCTACTAC
TTCATCGAAATTAACCCGCGCATCCAGGTCGAGCACACAATCACCGAGGAAATCACAGGCATCGACATCGTCGCT
GCCCAGATCCAGATCGCTGCCGGCGCGACCCTGTCGCAGCTCGGCCTGACGCAGGACCGCATCTCCACCCGCGGC
TTCGCCATCCAGTGCCGAATCACTACGGAGGACCCCGCCAAGCAGTTCCAGCCCGACACCGGCAAGATTGAGGTG
TACCGATCCGCCGGCGGCAACGGCGTTCGTCTCGACGGCGGCAACGGCTTTGCCGGCGCCGTCATCACGCCCTTT
TACGACTCCATGTTGGTCAAGTGTACGTGCCAGGGCTCCACGTACGAGATCGCCCGCCGGAAGGTCCTTCGGGCC
CTGATCGAGTTCCGGGTTCGCGGCGTCAAGACCAACATCCCCTTCCTCGTCTCCCTCCTCACCCATCCCACCTTC
ATCGACGGCACCTGCTGGACGACCTTCATCGACGACACCCCCCAGCTCTTCGACCTGGTCGGCAGCCAGAACCGC
GCCCAGAAGCTGCTGGCGTACCTCGGCGACGTCGCCGTCAACGGAAGCTCCATCAAGGGCCAGATTGGCGAGCCC
AAGTTCCGGGGCGAGCTCGTCCCGCCCCAGCTGCTCGCCTCCGACGGTCACAAGGTCGACGTCAGCGAGCCGTGC
CGCAAGGGCTGGCGGAACATCCTCGTCGAGCAGGGCCCCAAAGCCTTCGCCAAGGCCGTCCGCCAGTACAAGGGC
TGTCTGCTCATGGACACGACCTGGCGCGATGCCCACCAGTCCCTCCTGGCCACGCGCGTCCGCACCGTCGACCTG
CTGAACATTGCCAAGGAGACGAGCCACGCCCTCTCCAACCTGTACAGCCTGGAGTGCTGGGGCGGCGCCACGTTT
GACGTGGCGATGCGCTTCCTCTACGAGGACCCCTGGGACCGCCTCCGGAGGATGCGCAAGCTCGTCCCCAACATC
CCCTTCCAGATGCTCCTGCGAGGCGCCAACGGCGTTGCCTACTCGTCCCTCCCAGACAACGCCATCGACCACTTC
GTCGACCAGGCCAAGAAGAACGGCGTCGACATCTTCCGCGTCTTCGACGCCCTCAACGACATCGACCAGCTCGAG
GTCGGCATCAAGGCCGTCCACAAGGCCGGCGGCGTCGCCGAGGGCACCGTGTGCTACAGCGGCGACATGCTGAGC
CCCGGCAAGAAGTACAACTTGGAGTACTACATGGATCTCGTCGACAAGCTCGTCAAGCTGGACATCCACGTCCTC
GGCATCAAGGACATGGCCGGCGTCCTCAAACCCCACGCCGCCACCCTCCTGATTGGCTCCATTCGCAAGAAGTAC
CCCGACCTCCCCATCCACGTCCACACGCACGACTCGGCGGGCACGGGCGTCGCCTCGATGGTGGCCTGCGCCAAG
GCCGGCGCCGACGCCGTCGACGCCGCCACCGACAGCCTGTCCGGGATGACGTCGCAGCCCAGCATCAATGCCATC
ATCGCCTCGCTCGAGGGTAGCGATCTCGACCCCGGCCTGGACCCTAAGCAAGTCCGGGCCCTCGACGTCTACTGG
TCTCAGCTGCGCCTGCTCTACTCTCCCTTCGAGGCCCACCTCGCCGGCCCCGACCCCGAGGTGTATGAGCACGAG
ATCCCCGGAGGCCAGCTGACCAACATGATGTTCCAGGCCTCGCAGCTCGGCCTGGGCTCGCAGTGGCTGGAGACG
AAGAAGGCCTACGAGCACGCCAACGACCTCCTCGGTGACATCGTCAAGGTCACGCCGACGTCCAAGGTTGTTGGG
GACTTGGCGCAGTTCATGGTGTCCAACAAGCTGTCTGCCGAGGACGTCAAGGCCCGCGCGTCCGAGCTCGATTTT
CCCGGCTCCGTCCTTGAGTTCCTGGAGGGGCTCATGGGCCAGCCCTACGGAGGGTTCCCCGAGCCGCTGCGCTCG
AACGCGCTGCGCGGGCGACGGAAGCTCGACAAGCGACCCGGCCTGTTCCTCGACCCCGTCGACTTTTCCAAGGCC
AAGAAGGAGATCGCCAAGAAGTTTGGCGGCCCCGTGACGGAGTGCGACATTGCATCGTACGTCATGTACCCCAAG
GTGTTCGAGGACTACAAGAAGTTCGTGCAGCAGTACGGCGACCTGTCCGTCCTGCCGACCAAGTACTTCCTGTCG
CGACCCGAGATCGGCGAGGAGTTCAACGTCGAGCTGGAGAAGGGCAAGGTGCTCATCCTGAAGCTGCTGGCGGTG
GGTCCGTTGAGCGAGAACACGGGCCAGCGCGAGGTCTTTTTCGAGATGAACGGCGAGGTTCGGCAGGTGACGGTC
ATGGATAAGCAGGCGGCAGTCGAGAACATCAGCCGTCCGAAGGCGGACCCCGGCGACTCGAGCCAGGTCGGCGCG
CCCATGTCGGGCGTCCTGGTGGAGATGAGGGTACACGAGGGCTCCGACGTCAAGAAGGGCGACCCGCTCGCGGTC
TTGTCGGCCATGAAAATGGAAATGGTCATCTCGGCCCCTCACAGCGGAAAGGTGGCGAGCCTGCAGGTCAAGGAG
GGCGACTCGGTTGACGGATCGGACCTGGTGTGCCGAATTACCAAGGGCTGA
Transcript >Hirsu2|364
ATGGCGATGGCGGCCCCTCAACAGACTCTGAGCTTCAACGATGTTTTCGAAGACGATGATGTCGACGAGCCCAAG
TCGGTCCACCACATCCGCGCCAACTCGAGCATCATGCAGCTTAAAAAGATCCTTGTTGCCAATCGTGGTGAAATC
CCCATTCGGATTTTCAGGACTGCCCATGAACTATCTCTGCACACTATTGCCGTCTTCAGTTATGAGGACCGTCTG
AGCATGCATCGGCAAAAGGCTGACGAGGCCTACGTCATCGGCAAGCGTGGCCAGTATACCCCTGTCGGAGCTTAT
CTCGCCGGCGACGAGATCATCAGAATTGCCGTCGAGCACGGCGCCCAACTGATCCACCCAGGCTACGGCTTCCTC
TCTGAAAACGCCGAGTTTGCCCGCAATGTCGAAAAGGCCGGCCTCATTTTTGTTGGCCCCAGTCCCGAAGTCATC
GACTCCTTGGGCGACAAGGTTTCCGCCCGTAAGTTGGCCATTGCGGCTGGTGTCCCCGTCGTGCCCGGTACCGAG
GGTGCCGTTGCCAGGTTTGAGGAGGTCAAGGCCTTCACCGACAAGTATGGCTTCCCCATCATCATCAAGGCCGCC
TACGGTGGCGGCGGCCGCGGCATGCGCGTCGTCCGCGAGCCGGAGAGCTTGAAGGAGCACTTCGAGAGAGCCACG
TCCGAGGCCAAGTCCGCCTTTGGCAACGGCACCGTCTTCGTCGAGCGCTTCCTCGACAAGCCCAAGCACATCGAG
GTGCAGCTCCTCGGCGACAACCACGGCAACATCGTCCACCTGTACGAGCGAGACTGTTCCGTCCAGCGCCGCCAC
CAAAAGGTTGTCGAGATCGCTCCGGCCAAAGACCTCCCGGCCGAGACGAGAGATGCCATCCTGGCAGACGCCGTC
AAGCTGGCCAAGTCGGTCAACTACCGCAATGCGGGCACCGCCGAGTTCCTCGTCGACCAGCAGAACCGCTACTAC
TTCATCGAAATTAACCCGCGCATCCAGGTCGAGCACACAATCACCGAGGAAATCACAGGCATCGACATCGTCGCT
GCCCAGATCCAGATCGCTGCCGGCGCGACCCTGTCGCAGCTCGGCCTGACGCAGGACCGCATCTCCACCCGCGGC
TTCGCCATCCAGTGCCGAATCACTACGGAGGACCCCGCCAAGCAGTTCCAGCCCGACACCGGCAAGATTGAGGTG
TACCGATCCGCCGGCGGCAACGGCGTTCGTCTCGACGGCGGCAACGGCTTTGCCGGCGCCGTCATCACGCCCTTT
TACGACTCCATGTTGGTCAAGTGTACGTGCCAGGGCTCCACGTACGAGATCGCCCGCCGGAAGGTCCTTCGGGCC
CTGATCGAGTTCCGGGTTCGCGGCGTCAAGACCAACATCCCCTTCCTCGTCTCCCTCCTCACCCATCCCACCTTC
ATCGACGGCACCTGCTGGACGACCTTCATCGACGACACCCCCCAGCTCTTCGACCTGGTCGGCAGCCAGAACCGC
GCCCAGAAGCTGCTGGCGTACCTCGGCGACGTCGCCGTCAACGGAAGCTCCATCAAGGGCCAGATTGGCGAGCCC
AAGTTCCGGGGCGAGCTCGTCCCGCCCCAGCTGCTCGCCTCCGACGGTCACAAGGTCGACGTCAGCGAGCCGTGC
CGCAAGGGCTGGCGGAACATCCTCGTCGAGCAGGGCCCCAAAGCCTTCGCCAAGGCCGTCCGCCAGTACAAGGGC
TGTCTGCTCATGGACACGACCTGGCGCGATGCCCACCAGTCCCTCCTGGCCACGCGCGTCCGCACCGTCGACCTG
CTGAACATTGCCAAGGAGACGAGCCACGCCCTCTCCAACCTGTACAGCCTGGAGTGCTGGGGCGGCGCCACGTTT
GACGTGGCGATGCGCTTCCTCTACGAGGACCCCTGGGACCGCCTCCGGAGGATGCGCAAGCTCGTCCCCAACATC
CCCTTCCAGATGCTCCTGCGAGGCGCCAACGGCGTTGCCTACTCGTCCCTCCCAGACAACGCCATCGACCACTTC
GTCGACCAGGCCAAGAAGAACGGCGTCGACATCTTCCGCGTCTTCGACGCCCTCAACGACATCGACCAGCTCGAG
GTCGGCATCAAGGCCGTCCACAAGGCCGGCGGCGTCGCCGAGGGCACCGTGTGCTACAGCGGCGACATGCTGAGC
CCCGGCAAGAAGTACAACTTGGAGTACTACATGGATCTCGTCGACAAGCTCGTCAAGCTGGACATCCACGTCCTC
GGCATCAAGGACATGGCCGGCGTCCTCAAACCCCACGCCGCCACCCTCCTGATTGGCTCCATTCGCAAGAAGTAC
CCCGACCTCCCCATCCACGTCCACACGCACGACTCGGCGGGCACGGGCGTCGCCTCGATGGTGGCCTGCGCCAAG
GCCGGCGCCGACGCCGTCGACGCCGCCACCGACAGCCTGTCCGGGATGACGTCGCAGCCCAGCATCAATGCCATC
ATCGCCTCGCTCGAGGGTAGCGATCTCGACCCCGGCCTGGACCCTAAGCAAGTCCGGGCCCTCGACGTCTACTGG
TCTCAGCTGCGCCTGCTCTACTCTCCCTTCGAGGCCCACCTCGCCGGCCCCGACCCCGAGGTGTATGAGCACGAG
ATCCCCGGAGGCCAGCTGACCAACATGATGTTCCAGGCCTCGCAGCTCGGCCTGGGCTCGCAGTGGCTGGAGACG
AAGAAGGCCTACGAGCACGCCAACGACCTCCTCGGTGACATCGTCAAGGTCACGCCGACGTCCAAGGTTGTTGGG
GACTTGGCGCAGTTCATGGTGTCCAACAAGCTGTCTGCCGAGGACGTCAAGGCCCGCGCGTCCGAGCTCGATTTT
CCCGGCTCCGTCCTTGAGTTCCTGGAGGGGCTCATGGGCCAGCCCTACGGAGGGTTCCCCGAGCCGCTGCGCTCG
AACGCGCTGCGCGGGCGACGGAAGCTCGACAAGCGACCCGGCCTGTTCCTCGACCCCGTCGACTTTTCCAAGGCC
AAGAAGGAGATCGCCAAGAAGTTTGGCGGCCCCGTGACGGAGTGCGACATTGCATCGTACGTCATGTACCCCAAG
GTGTTCGAGGACTACAAGAAGTTCGTGCAGCAGTACGGCGACCTGTCCGTCCTGCCGACCAAGTACTTCCTGTCG
CGACCCGAGATCGGCGAGGAGTTCAACGTCGAGCTGGAGAAGGGCAAGGTGCTCATCCTGAAGCTGCTGGCGGTG
GGTCCGTTGAGCGAGAACACGGGCCAGCGCGAGGTCTTTTTCGAGATGAACGGCGAGGTTCGGCAGGTGACGGTC
ATGGATAAGCAGGCGGCAGTCGAGAACATCAGCCGTCCGAAGGCGGACCCCGGCGACTCGAGCCAGGTCGGCGCG
CCCATGTCGGGCGTCCTGGTGGAGATGAGGGTACACGAGGGCTCCGACGTCAAGAAGGGCGACCCGCTCGCGGTC
TTGTCGGCCATGAAAATGGAAATGGTCATCTCGGCCCCTCACAGCGGAAAGGTGGCGAGCCTGCAGGTCAAGGAG
GGCGACTCGGTTGACGGATCGGACCTGGTGTGCCGAATTACCAAGGGCTGA
Gene >Hirsu2|364
ATGGCGATGGCGGCCCCTCAACAGACTCTGAGCTTCAACGATGTTTTCGAAGACGATGATGTCGACGAGCCCAAG
TCGGTCCACCACATCCGCGCCAACTCGAGCATCATGCAGCTTAAAAAGATCCTTGGTGAGCGGCCCGACTTCGCC
TCTCCGCCCGCTTCCGGGCCTGGCTATCGTCTCCGTCGAGGCCCCCCTTCTGACTGACTGTGCTCTGCCATTGGC
CCTCAGTTGCCAATCGTGGTGAAATCCGTGAGTCCCCTCCTCCGATTCCGCCACCTCTGCCGACTTTGCCGCTGA
CCCTGCTGATTTGCGCAAGCCATTCGGGTACGAATTGGCAGCCCCCCCCCCTACCAGTTGCAGCCTCCCACCCTT
CGACTCTGCTGACCGTCCCTCGCCGTGACAGATTTTCAGGACTGTAGGTGCTCATCTACGCCGATTTGAGGCCGT
TCGGCGCTGACGCTGGAATACTAGGCCCATGAACTATCTCTGCACACTATTGCCGTCTTCAGGTACCGTCTCCGA
GCGCACCTCGGTTCTCGGCCTGTGCCGCTGACGCTCGTCCAGTTATGAGGACCGTCTGAGCATGCATCGGCAAAG
TATGGAAGACGTCTTGTCTCTCGCCCTGTTCCTGCAGCGTCTTCTGTGCGGCTGACACTGGTGGCTACAGAGGCT
GACGAGGCCTACGTCATCGGCAAGCGTGGCCAGTATACCCCTGTCGGAGCTTATCTCGCCGGCGACGAGATCATC
AGAATTGCCGTCGAGCACGGCGCCCAACTGATCCACCCAGGTTGGTTCTGTCCATTCTGCCGCCGCCCCCCTTTC
CCATTCCGGGCCCGTCCTGACTTGGATCCAGGCTACGGCTTCCTCTCTGAAAACGCCGAGTTTGCCCGCAATGTC
GAAAAGGCCGGCCTCATTGTAAGCCAACCTCGCTCTCAACTGCCGGCCTGGAAGATGCGAGCTGACCAACGGTGG
TGTCGCCGTAGTTTGTTGGCCCCAGTCCCGAAGTCATCGACTCCTTGGGCGACAAGGTTTCCGCCCGTAAGTTGG
CCATTGCGGCTGGTGTCCCCGTCGTGCCCGGTACCGAGGGTGCCGTTGCCAGGTTTGAGGAGGTCAAGGCCTTCA
CCGACAAGTATGGCTTCCCCATCATCATCAAGGCCGCCTACGGTGGCGGCGGCCGCGGCATGCGCGTCGTCCGCG
AGCCGGAGAGCTTGAAGGAGCACTTCGAGAGAGCCACGTCCGAGGCCAAGTCCGCCTTTGGCAACGGCACCGTCT
TCGTCGAGCGCTTCCTCGACAAGCCCAAGCACATCGAGGTGCAGCTCCTCGGCGACAACCACGGCAACATCGTCC
ACCTGTACGAGCGAGACTGTTCCGTCCAGCGCCGCCACCAAAAGGTTGTCGAGATCGCTCCGGCCAAAGACCTCC
CGGCCGAGACGAGAGATGCCATCCTGGCAGACGCCGTCAAGCTGGCCAAGTCGGTCAACTACCGCAATGCGGGCA
CCGCCGAGTTCCTCGTCGACCAGCAGAACCGCTACTACTTCATCGAAATTAACCCGCGCATCCAGGTCGAGCACA
CAATCACCGAGGAAATCACAGGCATCGACATCGTCGCTGCCCAGATCCAGATCGCTGCCGGCGCGACCCTGTCGC
AGCTCGGCCTGACGCAGGACCGCATCTCCACCCGCGGCTTCGCCATCCAGTGCCGAATCACTACGGAGGACCCCG
CCAAGCAGTTCCAGCCCGACACCGGCAAGATTGAGGTGTACCGATCCGCCGGCGGCAACGGCGTTCGTCTCGACG
GCGGCAACGGCTTTGCCGGCGCCGTCATCACGCCCTTTTACGACTCCATGTTGGTCAAGTGTACGTGCCAGGGCT
CCACGTACGAGATCGCCCGCCGGAAGGTCCTTCGGGCCCTGATCGAGTTCCGGGTTCGCGGCGTCAAGACCAACA
TCCCCTTCCTCGTCTCCCTCCTCACCCATCCCACCTTCATCGACGGCACCTGCTGGACGACCTTCATCGACGACA
CCCCCCAGCTCTTCGACCTGGTCGGCAGCCAGAACCGCGCCCAGAAGCTGCTGGCGTACCTCGGCGACGTCGCCG
TCAACGGAAGCTCCATCAAGGGCCAGATTGGCGAGCCCAAGTTCCGGGGCGAGCTCGTCCCGCCCCAGCTGCTCG
CCTCCGACGGTCACAAGGTCGACGTCAGCGAGCCGTGCCGCAAGGGCTGGCGGAACATCCTCGTCGAGCAGGGCC
CCAAAGCCTTCGCCAAGGCCGTCCGCCAGTACAAGGGCTGTCTGCTCATGGACACGACCTGGCGCGATGCCCACC
AGTCCCTCCTGGCCACGCGCGTCCGCACCGTCGACCTGCTGAACATTGCCAAGGAGACGAGCCACGCCCTCTCCA
ACCTGTACAGCCTGGAGTGCTGGGGCGGCGCCACGTTTGACGTGGCGATGCGCTTCCTCTACGAGGACCCCTGGG
ACCGCCTCCGGAGGATGCGCAAGCTCGTCCCCAACATCCCCTTCCAGATGCTCCTGCGAGGCGCCAACGGCGTTG
CCTACTCGTCCCTCCCAGACAACGCCATCGACCACTTCGTCGACCAGGCCAAGAAGAACGGCGTCGACATCTTCC
GCGTCTTCGACGCCCTCAACGACATCGACCAGCTCGAGGTCGGCATCAAGGCCGTCCACAAGGCCGGCGGCGTCG
CCGAGGGCACCGTGTGCTACAGCGGCGACATGCTGAGCCCCGGCAAGAAGTACAACTTGGAGTACTACATGGATC
TCGTCGACAAGCTCGTCAAGCTGGACATCCACGTCCTCGGCATCAAGGACATGGCCGGCGTCCTCAAACCCCACG
CCGCCACCCTCCTGATTGGCTCCATTCGCAAGAAGTACCCCGACCTCCCCATCCACGTCCACACGCACGACTCGG
CGGGCACGGGCGTCGCCTCGATGGTGGCCTGCGCCAAGGCCGGCGCCGACGCCGTCGACGCCGCCACCGACAGCC
TGTCCGGGATGACGTCGCAGCCCAGCATCAATGCCATCATCGCCTCGCTCGAGGGTAGCGATCTCGACCCCGGCC
TGGACCCTAAGCAAGTCCGGGCCCTCGACGTCTACTGGTCTCAGCTGCGCCTGCTCTACTCTCCCTTCGAGGCCC
ACCTCGCCGGCCCCGACCCCGAGGTGTATGAGCACGAGATCCCCGGAGGCCAGCTGACCAACATGATGTTCCAGG
CCTCGCAGCTCGGCCTGGGCTCGCAGTGGCTGGAGACGAAGAAGGCCTACGAGCACGCCAACGACCTCCTCGGTG
ACATCGTCAAGGTCACGCCGACGTCCAAGGTTGTTGGGGACTTGGCGCAGTTCATGGTGTCCAACAAGCTGTCTG
CCGAGGACGTCAAGGCCCGCGCGTCCGAGCTCGATTTTCCCGGCTCCGTCCTTGAGTTCCTGGAGGGGCTCATGG
GCCAGCCCTACGGAGGGTTCCCCGAGCCGCTGCGCTCGAACGCGCTGCGCGGGCGACGGAAGCTCGACAAGCGAC
CCGGCCTGTTCCTCGACCCCGTCGACTTTTCCAAGGCCAAGAAGGAGATCGCCAAGAAGTTTGGCGGCCCCGTGA
CGGAGTGCGACATTGCATCGTACGTCATGTACCCCAAGGTGTTCGAGGACTACAAGAAGTTCGTGCAGCAGTACG
GCGACCTGTCCGTCCTGCCGACCAAGTACTTCCTGTCGCGACCCGAGATCGGCGAGGAGTTCAACGTCGAGCTGG
AGAAGGGCAAGGTGCTCATCCTGAAGCTGCTGGCGGTGGGTCCGTTGAGCGAGAACACGGGCCAGCGCGAGGTCT
TTTTCGAGATGAACGGCGAGGTTCGGCAGGTGACGGTCATGGATAAGCAGGCGGCAGTCGAGAACATCAGCCGTC
CGAAGGCGGACCCCGGCGACTCGAGCCAGGTCGGCGCGCCCATGTCGGGCGTCCTGGTGGAGATGAGGGTACACG
AGGGCTCCGACGTCAAGAAGGGCGACCCGCTCGCGGTCTTGTCGGCCATGAAAATGGTAGGTGGACAAGGTCGAC
ACGTGACGGGCGCGGTGCCCTTGCTAACCGCTCTCAGGAAATGGTCATCTCGGCCCCTCACAGCGGAAAGGTGGC
GAGCCTGCAGGTCAAGGAGGGCGACTCGGTTGACGGATCGGACCTGGTGTGCCGAATTACCAAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail