Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3624
Gene name
LocationContig_1966:86..387
Strand+
Gene length (bp)301
Transcript length (bp)228
Coding sequence length (bp)228
Protein length (aa) 76

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Mitochondrial transit peptide 0.4806 0.4148 0.5728 0.1385 0.4761 0.0785 0.0425 0.2449 0.3054 0.0077

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7570
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|3624 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3624
LVSLAILHARGLRLPVVYDTSAFDFDSLDSLRLMNGLVGIYLADFKLWEPASSRRLLKADDYAATARESVRAMHA
*
Coding >Hirsu2|3624
CTGGTCTCCCTCGCCATCCTGCACGCCCGCGGCCTGCGCCTGCCCGTCGTCTACGACACGTCCGCCTTCGACTTC
GACTCGCTCGACTCGCTGCGCCTCATGAACGGCCTCGTCGGCATCTACCTCGCCGACTTCAAGCTCTGGGAGCCC
GCCTCGTCGCGCCGCCTGCTCAAGGCCGACGACTACGCCGCCACCGCCCGCGAGAGCGTCCGCGCCATGCACGCC
TAG
Transcript >Hirsu2|3624
CTGGTCTCCCTCGCCATCCTGCACGCCCGCGGCCTGCGCCTGCCCGTCGTCTACGACACGTCCGCCTTCGACTTC
GACTCGCTCGACTCGCTGCGCCTCATGAACGGCCTCGTCGGCATCTACCTCGCCGACTTCAAGCTCTGGGAGCCC
GCCTCGTCGCGCCGCCTGCTCAAGGCCGACGACTACGCCGCCACCGCCCGCGAGAGCGTCCGCGCCATGCACGCC
TAG
Gene >Hirsu2|3624
CTGGTTCGTCCGGTTGCAGGACGCCGGCGGCGCGCACAACATCAACCTCGTCACGCCCGAGCACGTCGTGCCCCA
GGTCTCCCTCGCCATCCTGCACGCCCGCGGCCTGCGCCTGCCCGTCGTCTACGACACGTCCGCCTTCGACTTCGA
CTCGCTCGACTCGCTGCGCCTCATGAACGGCCTCGTCGGCATCTACCTCGCCGACTTCAAGCTCTGGGAGCCCGC
CTCGTCGCGCCGCCTGCTCAAGGCCGACGACTACGCCGCCACCGCCCGCGAGAGCGTCCGCGCCATGCACGCCTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail