Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3617
Gene name
LocationContig_1963:134..1189
Strand-
Gene length (bp)1055
Transcript length (bp)816
Coding sequence length (bp)816
Protein length (aa) 272

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03467 Smg4_UPF3 Smg-4/UPF3 family 5.7E-51 77 255

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9FVW4|RENT3_ARATH Regulator of nonsense transcripts UPF3 OS=Arabidopsis thaliana GN=UPF3 PE=1 SV=1 77 255 9.0E-14
sp|Q9H1J1|REN3A_HUMAN Regulator of nonsense transcripts 3A OS=Homo sapiens GN=UPF3A PE=1 SV=1 80 259 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3617
MSAPAPQVLSRRANGAPHAPAGQPTDPPAAKGKSTLDAYAQRPSRARGSGDRGADGNARSANAGEAPKRSKPRPH
NEGEKLVVRRLPPGMTEAEFVSALGPEWEVNKGKVDWFSYCIGKVASDPSKLSRPSRAYLHLTRKDDMMALSQAV
RAATWEDASGTFTSSSLIGPPSLEFSTYKKVPGSRRRTDPRQGTIDQDQEFMAFLEGLANPAPPRESVEVEDADE
TAKEDGNNNSGSGAKVTTTPLVEFLKEKKANKGKDGAAGKNAKSGN*
Coding >Hirsu2|3617
ATGTCTGCTCCGGCGCCGCAGGTCCTGTCCCGTAGGGCAAACGGAGCGCCTCACGCCCCCGCCGGCCAGCCGACC
GATCCTCCTGCCGCCAAGGGCAAGTCGACCCTCGACGCCTACGCGCAGCGGCCGTCGCGAGCGAGGGGCTCCGGC
GACCGAGGCGCCGACGGCAACGCCAGGAGCGCCAACGCGGGCGAGGCCCCCAAACGATCCAAGCCGCGGCCTCAC
AACGAGGGCGAGAAACTCGTCGTCCGCCGCCTGCCGCCCGGCATGACCGAGGCCGAGTTCGTCTCGGCCCTGGGG
CCGGAGTGGGAGGTGAACAAGGGCAAGGTCGACTGGTTCTCCTACTGCATCGGAAAAGTGGCCTCGGACCCCTCG
AAGCTGTCGCGCCCCAGCCGGGCCTACCTTCACCTGACGCGAAAGGACGACATGATGGCCCTCAGCCAGGCCGTG
CGCGCCGCCACCTGGGAGGATGCTAGCGGGACCTTTACGAGCTCCTCGCTCATCGGCCCGCCCAGCCTCGAGTTC
TCGACCTACAAGAAAGTCCCCGGCAGCAGGCGACGGACCGACCCGCGACAGGGGACCATCGACCAGGACCAGGAG
TTCATGGCCTTCCTCGAGGGCCTCGCGAACCCAGCCCCTCCGAGGGAGAGCGTCGAGGTCGAAGACGCCGACGAG
ACAGCCAAGGAAGACGGCAACAACAACAGCGGCAGCGGCGCCAAGGTCACCACCACCCCGCTCGTCGAGTTTCTC
AAGGAGAAGAAGGCCAACAAGGGCAAGGACGGCGCGGCCGGCAAGAACGCAAAGTCTGGGAATTGA
Transcript >Hirsu2|3617
ATGTCTGCTCCGGCGCCGCAGGTCCTGTCCCGTAGGGCAAACGGAGCGCCTCACGCCCCCGCCGGCCAGCCGACC
GATCCTCCTGCCGCCAAGGGCAAGTCGACCCTCGACGCCTACGCGCAGCGGCCGTCGCGAGCGAGGGGCTCCGGC
GACCGAGGCGCCGACGGCAACGCCAGGAGCGCCAACGCGGGCGAGGCCCCCAAACGATCCAAGCCGCGGCCTCAC
AACGAGGGCGAGAAACTCGTCGTCCGCCGCCTGCCGCCCGGCATGACCGAGGCCGAGTTCGTCTCGGCCCTGGGG
CCGGAGTGGGAGGTGAACAAGGGCAAGGTCGACTGGTTCTCCTACTGCATCGGAAAAGTGGCCTCGGACCCCTCG
AAGCTGTCGCGCCCCAGCCGGGCCTACCTTCACCTGACGCGAAAGGACGACATGATGGCCCTCAGCCAGGCCGTG
CGCGCCGCCACCTGGGAGGATGCTAGCGGGACCTTTACGAGCTCCTCGCTCATCGGCCCGCCCAGCCTCGAGTTC
TCGACCTACAAGAAAGTCCCCGGCAGCAGGCGACGGACCGACCCGCGACAGGGGACCATCGACCAGGACCAGGAG
TTCATGGCCTTCCTCGAGGGCCTCGCGAACCCAGCCCCTCCGAGGGAGAGCGTCGAGGTCGAAGACGCCGACGAG
ACAGCCAAGGAAGACGGCAACAACAACAGCGGCAGCGGCGCCAAGGTCACCACCACCCCGCTCGTCGAGTTTCTC
AAGGAGAAGAAGGCCAACAAGGGCAAGGACGGCGCGGCCGGCAAGAACGCAAAGTCTGGGAATTGA
Gene >Hirsu2|3617
ATGTCTGCTCCGGCGCCGCAGGTCCTGTCCCGTAGGGCAAACGGAGCGCCTCACGCCCCCGCCGGCCAGCCGACC
GATCCTCCTGCCGCCAAGGTGAGCGCCCCGAGCCGGCGTCGCCTCCACCCTGCCGCTTCTGACGACGCCTCCAAG
GGCAAGTCGACCCTCGACGCCTACGCGCAGCGGCCGTCGCGAGCGAGGGGCTCCGGCGACCGAGGCGCCGACGGC
AACGCCAGGGTACGTCCCCGGCATCCGCCTTGGCCCCAGCCCTGCCCCGACCTCCTGACACTTGTCTCCAGAGCG
CCAACGCGGGCGAGGCCCCCAAACGATCCAAGCCGCGGCCTCACAACGAGGGCGAGAAACTCGTCGTCCGCCGCC
TGCCGCCCGGCATGACCGAGGCCGAGTTCGTCTCGGCCCTGGGGCCGGAGTGGGAGGTGAACAAGGGCAAGGTCG
ACTGGTTCTCCTACTGCATCGGAAAAGTGGCCTCGGAGTGAGTCAGGGCCGCGTGGTGCGAGAGGTGCGGCTGCG
CTGACCGTCTGCACCCTCCAGCCCCTCGAAGCTGTCGCGCCCCAGCCGGGCCTACCTTCACCTGACGCGAAAGGA
CGACATGATGGCCCTCAGCCAGGCCGTGCGCGCCGCCACCTGGGAGGATGCTAGCGGGACCTTTACGAGCTCCTC
GCTCATCGGCCCGCCCAGCCTCGAGTTCTCGACCTACAAGAAAGTCCCCGGCAGCAGGCGACGGACCGACCCGCG
ACAGGGGACCATCGACCAGGACCAGGAGTTCATGGCCTTCCTCGAGGGCCTCGCGAACCCAGCCCCTCCGAGGGA
GAGCGTCGAGGTCGAAGACGCCGACGAGACAGCCAAGGAAGACGGCAACAACAACAGCGGCAGCGGCGCCAAGGT
CACCACCACCCCGCTCGTCGAGTTTCTCAAGGAGAAGAAGGCCAACAAGGGCAAGGACGGCGCGGCCGGCAAGAA
CGCAAAGTCTGGGTCAGCAAAGGGCAAGGGAGGCGCCAAGGAGGAGGAGACGGCCAAGAAGAGGGGGGCCAAGGA
ATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail