Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3616
Gene name
LocationContig_1962:969..2635
Strand-
Gene length (bp)1666
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04882 Peroxin-3 Peroxin-3 1.7E-166 7 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q874C0|PEX3_YARLI Peroxisomal biogenesis factor 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX3 PE=3 SV=1 8 467 3.0E-67
sp|Q01497|PEX3_PICAN Peroxisomal biogenesis factor 3 OS=Pichia angusta GN=PEX3 PE=3 SV=1 1 465 3.0E-49
sp|Q92262|PEX3_PICPA Peroxisomal biogenesis factor 3 OS=Komagataella pastoris GN=PEX3 PE=1 SV=1 1 465 7.0E-44
sp|Q6BK00|PEX3_DEBHA Peroxisomal biogenesis factor 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX3 PE=3 SV=1 1 468 6.0E-38
sp|P28795|PEX3_YEAST Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX3 PE=1 SV=1 5 465 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q874C0|PEX3_YARLI Peroxisomal biogenesis factor 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX3 PE=3 SV=1 8 467 3.0E-67
sp|Q01497|PEX3_PICAN Peroxisomal biogenesis factor 3 OS=Pichia angusta GN=PEX3 PE=3 SV=1 1 465 3.0E-49
sp|Q92262|PEX3_PICPA Peroxisomal biogenesis factor 3 OS=Komagataella pastoris GN=PEX3 PE=1 SV=1 1 465 7.0E-44
sp|Q6BK00|PEX3_DEBHA Peroxisomal biogenesis factor 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX3 PE=3 SV=1 1 468 6.0E-38
sp|P28795|PEX3_YEAST Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX3 PE=1 SV=1 5 465 2.0E-27
sp|Q60HE1|PEX3_MACFA Peroxisomal biogenesis factor 3 OS=Macaca fascicularis GN=PEX3 PE=2 SV=1 169 463 4.0E-25
sp|P56589|PEX3_HUMAN Peroxisomal biogenesis factor 3 OS=Homo sapiens GN=PEX3 PE=1 SV=1 169 463 7.0E-25
sp|Q9JJK3|PEX3_CRILO Peroxisomal biogenesis factor 3 OS=Cricetulus longicaudatus GN=PEX3 PE=2 SV=1 169 463 7.0E-25
sp|Q9JJK4|PEX3_RAT Peroxisomal biogenesis factor 3 OS=Rattus norvegicus GN=Pex3 PE=1 SV=1 169 463 7.0E-24
sp|A6H7C2|PEX3_BOVIN Peroxisomal biogenesis factor 3 OS=Bos taurus GN=PEX3 PE=2 SV=1 169 463 9.0E-24
sp|Q9QXY9|PEX3_MOUSE Peroxisomal biogenesis factor 3 OS=Mus musculus GN=Pex3 PE=1 SV=1 169 463 4.0E-23
sp|Q759H4|PEX3_ASHGO Peroxisomal biogenesis factor 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX3 PE=3 SV=1 41 465 4.0E-22
sp|O94227|PEX3_KLULA Peroxisomal biogenesis factor 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX3 PE=3 SV=1 43 465 1.0E-21
sp|Q60HE1|PEX3_MACFA Peroxisomal biogenesis factor 3 OS=Macaca fascicularis GN=PEX3 PE=2 SV=1 1 90 2.0E-08
sp|P56589|PEX3_HUMAN Peroxisomal biogenesis factor 3 OS=Homo sapiens GN=PEX3 PE=1 SV=1 1 90 2.0E-08
sp|Q9JJK3|PEX3_CRILO Peroxisomal biogenesis factor 3 OS=Cricetulus longicaudatus GN=PEX3 PE=2 SV=1 1 90 3.0E-08
sp|Q9QXY9|PEX3_MOUSE Peroxisomal biogenesis factor 3 OS=Mus musculus GN=Pex3 PE=1 SV=1 1 90 3.0E-08
sp|Q9JJK4|PEX3_RAT Peroxisomal biogenesis factor 3 OS=Rattus norvegicus GN=Pex3 PE=1 SV=1 1 90 6.0E-08
sp|A6H7C2|PEX3_BOVIN Peroxisomal biogenesis factor 3 OS=Bos taurus GN=PEX3 PE=2 SV=1 1 90 6.0E-08
sp|Q8S9K7|PEX32_ARATH Peroxisome biogenesis protein 3-2 OS=Arabidopsis thaliana GN=PEX3-2 PE=2 SV=1 169 465 2.0E-07
sp|Q8LDG7|PEX31_ARATH Peroxisome biogenesis protein 3-1 OS=Arabidopsis thaliana GN=PEX3-1 PE=2 SV=2 169 465 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005779 integral component of peroxisomal membrane Yes
GO:0007031 peroxisome organization Yes
GO:0044446 intracellular organelle part No
GO:0009987 cellular process No
GO:0031231 intrinsic component of peroxisomal membrane No
GO:0044439 peroxisomal part No
GO:0044424 intracellular part No
GO:0016021 integral component of membrane No
GO:0016043 cellular component organization No
GO:0071840 cellular component organization or biogenesis No
GO:0006996 organelle organization No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044425 membrane part No
GO:0044438 microbody part No
GO:0031301 integral component of organelle membrane No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0044422 organelle part No
GO:0031300 intrinsic component of organelle membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 176 198 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3616
MLASARRWLRKNRTPIAVGVGVVGAAYVVSQYVLAKINDARERMSSERIAKENLRRRFEQNQEDCTFTVLALLPT
ATANILAVLNTEQITYEIQQIKSSAKGPRAAASDSTSPPSIADTTLTEEDGKSMASLHSESGIHASQIAAPSPLA
AAGDAGHQDGGVPRARKTKRQLWDDLTISAVTRAFTLIYTLALLAMLTRVQLNLLGRRSYLSSVVSLATGAQQAT
ISLENNDDDKTEHDYGSDFDTNRKYLTFSWWLLNRGWVELMGRVESAVRAVFGSLSPRDLVTFHRFGELTMEVRR
LVEGATPEERRRAGWLTVVLPPREQEADVIRESGILEDNNSSAAAAAAAPRPSPAALRRLLDETADLVESPAFSH
VLTLVLDASFSLLVDKKLAAEAFELPASTEAAAAPGATDPRWSKAILLPKILSVLTRQAHAIGNGMPNEYLQEME
TVRAVEAFAAVVYSSNWENEMRDEGLMGAAAAQLSTERAAHGGEQSLVVLDRQGGFEGAWERATEKR*
Coding >Hirsu2|3616
ATGCTCGCCTCGGCCCGCCGCTGGCTTCGCAAGAACCGGACGCCCATCGCCGTGGGCGTGGGCGTCGTCGGCGCC
GCCTACGTCGTCTCGCAATATGTCTTGGCCAAGATCAACGACGCCCGCGAGCGCATGAGCAGCGAGCGCATCGCC
AAGGAGAACCTGCGCCGGCGGTTCGAGCAGAACCAGGAGGACTGCACCTTCACCGTCCTGGCCCTCCTGCCGACG
GCGACGGCCAACATCCTCGCCGTCCTCAACACGGAGCAGATCACGTACGAGATCCAGCAGATCAAGAGCTCCGCC
AAGGGCCCCCGCGCCGCCGCCAGCGACTCCACCAGCCCGCCCAGCATCGCCGACACGACGCTGACGGAGGAGGAC
GGCAAGAGCATGGCCAGCTTGCACAGTGAGAGCGGCATCCACGCCAGCCAGATCGCCGCGCCCTCGCCCCTGGCC
GCCGCCGGCGACGCGGGGCACCAGGACGGCGGAGTGCCGCGGGCCCGCAAGACCAAGCGCCAGCTCTGGGACGAC
CTGACCATCAGCGCCGTCACGAGGGCCTTCACCCTCATCTACACCCTCGCCCTCCTGGCCATGTTGACCCGGGTC
CAGCTCAACCTCCTCGGCCGCCGGAGCTACCTGTCGAGCGTCGTCTCGCTCGCCACCGGCGCCCAGCAGGCCACC
ATCAGCCTGGAGAACAACGACGACGACAAGACGGAGCACGACTACGGCAGCGACTTCGACACCAACCGCAAGTAC
CTCACCTTCAGCTGGTGGCTCCTCAACCGCGGCTGGGTCGAGCTGATGGGCCGCGTCGAGAGCGCCGTCCGCGCC
GTCTTCGGCAGCCTCAGCCCCCGCGACCTCGTCACCTTCCACCGCTTCGGCGAGTTGACCATGGAGGTCAGGAGG
CTGGTCGAGGGCGCCACGCCCGAGGAGCGGCGCCGCGCCGGCTGGCTCACCGTCGTGCTCCCGCCCCGCGAGCAG
GAGGCCGACGTCATCCGGGAGTCGGGCATCCTCGAGGACAACAACTCGTCGGCCGCCGCCGCCGCCGCCGCCCCT
CGGCCCTCGCCCGCCGCCCTCCGCCGCCTGCTCGACGAGACGGCCGACCTGGTCGAGTCGCCCGCCTTCTCGCAC
GTCCTGACCCTCGTCCTCGACGCCTCCTTCTCCCTGCTCGTCGACAAGAAGCTGGCGGCCGAGGCCTTCGAGCTC
CCCGCCTCGACGGAGGCGGCGGCCGCCCCGGGCGCGACGGACCCGCGCTGGTCCAAGGCCATACTGCTCCCCAAG
ATCCTCTCGGTACTGACGCGCCAGGCACACGCCATCGGCAACGGCATGCCCAACGAGTATCTCCAGGAGATGGAG
ACGGTCCGGGCCGTCGAGGCCTTCGCCGCCGTCGTCTACTCGAGCAACTGGGAGAACGAGATGCGCGACGAGGGC
CTCATGGGTGCCGCCGCCGCGCAGCTGAGCACGGAACGCGCGGCCCACGGCGGCGAGCAGAGCCTCGTCGTCTTG
GACCGGCAGGGCGGGTTCGAGGGCGCGTGGGAGAGGGCGACGGAGAAGAGATGA
Transcript >Hirsu2|3616
ATGCTCGCCTCGGCCCGCCGCTGGCTTCGCAAGAACCGGACGCCCATCGCCGTGGGCGTGGGCGTCGTCGGCGCC
GCCTACGTCGTCTCGCAATATGTCTTGGCCAAGATCAACGACGCCCGCGAGCGCATGAGCAGCGAGCGCATCGCC
AAGGAGAACCTGCGCCGGCGGTTCGAGCAGAACCAGGAGGACTGCACCTTCACCGTCCTGGCCCTCCTGCCGACG
GCGACGGCCAACATCCTCGCCGTCCTCAACACGGAGCAGATCACGTACGAGATCCAGCAGATCAAGAGCTCCGCC
AAGGGCCCCCGCGCCGCCGCCAGCGACTCCACCAGCCCGCCCAGCATCGCCGACACGACGCTGACGGAGGAGGAC
GGCAAGAGCATGGCCAGCTTGCACAGTGAGAGCGGCATCCACGCCAGCCAGATCGCCGCGCCCTCGCCCCTGGCC
GCCGCCGGCGACGCGGGGCACCAGGACGGCGGAGTGCCGCGGGCCCGCAAGACCAAGCGCCAGCTCTGGGACGAC
CTGACCATCAGCGCCGTCACGAGGGCCTTCACCCTCATCTACACCCTCGCCCTCCTGGCCATGTTGACCCGGGTC
CAGCTCAACCTCCTCGGCCGCCGGAGCTACCTGTCGAGCGTCGTCTCGCTCGCCACCGGCGCCCAGCAGGCCACC
ATCAGCCTGGAGAACAACGACGACGACAAGACGGAGCACGACTACGGCAGCGACTTCGACACCAACCGCAAGTAC
CTCACCTTCAGCTGGTGGCTCCTCAACCGCGGCTGGGTCGAGCTGATGGGCCGCGTCGAGAGCGCCGTCCGCGCC
GTCTTCGGCAGCCTCAGCCCCCGCGACCTCGTCACCTTCCACCGCTTCGGCGAGTTGACCATGGAGGTCAGGAGG
CTGGTCGAGGGCGCCACGCCCGAGGAGCGGCGCCGCGCCGGCTGGCTCACCGTCGTGCTCCCGCCCCGCGAGCAG
GAGGCCGACGTCATCCGGGAGTCGGGCATCCTCGAGGACAACAACTCGTCGGCCGCCGCCGCCGCCGCCGCCCCT
CGGCCCTCGCCCGCCGCCCTCCGCCGCCTGCTCGACGAGACGGCCGACCTGGTCGAGTCGCCCGCCTTCTCGCAC
GTCCTGACCCTCGTCCTCGACGCCTCCTTCTCCCTGCTCGTCGACAAGAAGCTGGCGGCCGAGGCCTTCGAGCTC
CCCGCCTCGACGGAGGCGGCGGCCGCCCCGGGCGCGACGGACCCGCGCTGGTCCAAGGCCATACTGCTCCCCAAG
ATCCTCTCGGTACTGACGCGCCAGGCACACGCCATCGGCAACGGCATGCCCAACGAGTATCTCCAGGAGATGGAG
ACGGTCCGGGCCGTCGAGGCCTTCGCCGCCGTCGTCTACTCGAGCAACTGGGAGAACGAGATGCGCGACGAGGGC
CTCATGGGTGCCGCCGCCGCGCAGCTGAGCACGGAACGCGCGGCCCACGGCGGCGAGCAGAGCCTCGTCGTCTTG
GACCGGCAGGGCGGGTTCGAGGGCGCGTGGGAGAGGGCGACGGAGAAGAGATGA
Gene >Hirsu2|3616
ATGCTCGCCTCGGCCCGCCGCTGGCTTCGCAAGAACCGGACGCCCATCGCCGTGGGCGTGGGCGTCGTCGGCGCC
GCCTACGTCGTCTCGCAATATGTCTTGGCCAAGATCAACGACGCCCGCGAGCGCATGAGCAGCGAGCGCATCGCC
AAGGAGAAGTGAGTCCCCCCCCCGGCGCCGTGACGAGCGGCCGGCTGACCCCCCCTGTGCTGCGCAGCCTGCGCC
GGCGGTTCGAGCAGAACCAGGAGGACTGCACCTTCACCGTCCTGGCCCTCCTGCCGACGGCGACGGCCAACATCC
TCGCCGTCCTCAACACGGAGCAGATCACGTACGAGATCCAGCAGATCAAGAGCTCCGCCAAGGGCCCCCGCGCCG
CCGCCAGCGACTCCACCAGCCCGCCCAGCATCGCCGACACGACGCTGACGGAGGAGGACGGCAAGAGCATGGCCA
GCTTGCACAGTGAGAGCGGCATCCACGCCAGCCAGATCGCCGCGCCCTCGCCCCTGGCCGCCGCCGGCGACGCGG
GGCACCAGGACGGCGGAGTGCCGCGGGCCCGCAAGACCAAGCGCCAGCTCTGGGACGACCTGACCATCAGCGGTG
CGCTGTCCCTGCGCTCCCCCACGGCCTGCGGCAAGCTGACAAGCGTCCAGCCGTCACGAGGGCCTTCACCCTCAT
CTACACCCTCGCCCTCCTGGCCATGTTGACCCGGGTCCAGCTCAACCTCCTCGGCCGCCGGAGCTACCTGTCGAG
CGTCGTCTCGCTCGCCACCGGCGCCCAGCAGGCCACCATCAGCCTGGAGAACAACGACGACGACAAGACGGAGCA
CGACTACGGCAGCGACTTCGACACCAACCGCAAGTACCTCACCTTCAGCTGGTGGCTCCTCAACCGCGGCTGGGT
CGAGCTGATGGGCCGCGTCGAGAGCGCCGTCCGCGCCGTCTTCGGCAGCCTCAGCCCCCGCGACCTCGTCACCTT
CCACCGCTTCGGCGAGTTGACCATGGAGGTCAGGAGGCTGGTCGAGGGCGCCACGCCCGAGGAGCGGCGCCGCGC
CGGCTGGCTCACCGTCGTGCTCCCGCCCCGCGAGCAGGAGGCCGACGTCATCCGGGAGTCGGGCATCCTCGAGGA
CAACAACTCGTCGGCCGCCGCCGCCGCCGCCGCCCCTCGGCCCTCGCCCGCCGCCCTCCGCCGCCTGCTCGACGA
GACGGCCGACCTGGTCGAGTCGCCCGCCTTCTCGCACGTCCTGACCCTCGTCCTCGACGCCTCCTTCTCCCTGCT
CGTCGACAAGAAGCTGGCGGCCGAGGCCTTCGAGCTCCCCGCCTCGACGGAGGCGGCGGCCGCCCCGGGCGCGAC
GGACCCGCGCTGGTCCAAGGCCATACTGCTCCCCAAGATCCTCTCGGTACTGACGCGCCAGGCACACGCCATCGG
CAACGGCATGCCCAACGAGTATCTCCAGGAGATGGAGACGGTCCGGGCCGTCGAGGCCTTCGCCGCCGTCGTCTA
CTCGAGCAACTGGGAGAACGAGATGCGCGACGAGGGCCTCATGGGTGCCGCCGCCGCGCAGCTGAGCACGGAACG
CGCGGCCCACGGCGGCGAGCAGAGCCTCGTCGTCTTGGACCGGCAGGGCGGGTTCGAGGGCGCGTGGGAGAGGGC
GACGGAGAAGAGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail