Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3606
Gene name
LocationContig_196:20496..22449
Strand+
Gene length (bp)1953
Transcript length (bp)1623
Coding sequence length (bp)1623
Protein length (aa) 541

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14821 Thr_synth_N Threonine synthase N terminus 1.3E-27 16 93
PF00291 PALP Pyridoxal-phosphate dependent enzyme 1.6E-17 105 460

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q42598|THRC_SCHPO Threonine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thrc PE=1 SV=1 16 506 4.0E-180
sp|P16120|THRC_YEAST Threonine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THR4 PE=1 SV=1 14 505 4.0E-179
sp|Q00063|THRC_ASHGO Threonine synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=THR4 PE=3 SV=1 14 538 6.0E-175
sp|P29363|THRC_PSEAE Threonine synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=thrC PE=3 SV=3 17 533 6.0E-128
sp|P37145|THRC_METGL Threonine synthase OS=Methylobacillus glycogenes GN=thrC PE=3 SV=1 17 534 5.0E-105
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q42598|THRC_SCHPO Threonine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=thrc PE=1 SV=1 16 506 4.0E-180
sp|P16120|THRC_YEAST Threonine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THR4 PE=1 SV=1 14 505 4.0E-179
sp|Q00063|THRC_ASHGO Threonine synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=THR4 PE=3 SV=1 14 538 6.0E-175
sp|P29363|THRC_PSEAE Threonine synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=thrC PE=3 SV=3 17 533 6.0E-128
sp|P37145|THRC_METGL Threonine synthase OS=Methylobacillus glycogenes GN=thrC PE=3 SV=1 17 534 5.0E-105
sp|P23669|THRC_CORGL Threonine synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=thrC PE=1 SV=2 17 534 9.0E-104
sp|Q5XH07|THNS2_XENLA Threonine synthase-like 2 OS=Xenopus laevis GN=thnsl2 PE=2 SV=1 17 536 2.0E-91
sp|Q86YJ6|THNS2_HUMAN Threonine synthase-like 2 OS=Homo sapiens GN=THNSL2 PE=2 SV=3 17 516 3.0E-87
sp|Q5RFE6|THNS2_PONAB Threonine synthase-like 2 OS=Pongo abelii GN=THNSL2 PE=2 SV=1 17 516 3.0E-86
sp|Q5M7T9|THNS2_RAT Threonine synthase-like 2 OS=Rattus norvegicus GN=Thnsl2 PE=2 SV=1 17 516 1.0E-82
sp|Q80W22|THNS2_MOUSE Threonine synthase-like 2 OS=Mus musculus GN=Thnsl2 PE=1 SV=1 17 532 4.0E-82
sp|Q2YDP8|THNS2_DANRE Threonine synthase-like 2 OS=Danio rerio GN=thnsl2 PE=2 SV=1 17 525 4.0E-81
sp|Q5R5P3|THNS1_PONAB Threonine synthase-like 1 OS=Pongo abelii GN=THNSL1 PE=2 SV=1 14 494 3.0E-69
sp|Q9BH05|THNS1_MACFA Threonine synthase-like 1 OS=Macaca fascicularis GN=THNSL1 PE=2 SV=1 14 494 7.0E-69
sp|Q8IYQ7|THNS1_HUMAN Threonine synthase-like 1 OS=Homo sapiens GN=THNSL1 PE=1 SV=2 14 494 9.0E-69
sp|Q8BH55|THNS1_MOUSE Threonine synthase-like 1 OS=Mus musculus GN=Thnsl1 PE=1 SV=1 14 494 5.0E-67
sp|P44503|THRC_HAEIN Threonine synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrC PE=3 SV=1 27 532 4.0E-63
sp|Q9ZMX5|THRC_HELPJ Threonine synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thrC PE=3 SV=1 17 500 2.0E-61
sp|P27735|THRC_SERMA Threonine synthase OS=Serratia marcescens GN=thrC PE=3 SV=1 24 531 2.0E-59
sp|O24924|THRC_HELPY Threonine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thrC PE=3 SV=1 17 500 5.0E-59
sp|Q8K9V1|THRC_BUCAP Threonine synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thrC PE=3 SV=1 21 533 4.0E-56
sp|P00934|THRC_ECOLI Threonine synthase OS=Escherichia coli (strain K12) GN=thrC PE=1 SV=1 24 533 5.0E-56
sp|Q89AR5|THRC_BUCBP Threonine synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=thrC PE=3 SV=1 27 486 2.0E-55
sp|P57289|THRC_BUCAI Threonine synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=thrC PE=3 SV=1 21 493 6.0E-55
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3606
MSDSAARAATHSPSQTYLSTRGGDHGLSFETVVLKGLAADGGLFLPEEIPKAADWESWSHLSYAELAFRILSLYI
STDEIPASDLKAIIDRSYSTFRDKDITPLKHLRDNLYLLELFHGPSYSFKDCALQFLGNLFEYFLVRRNQGKEGR
ERHHLTVVGATSGDTGSAAIYGLRGKQDVSVFILHPKGRISPLQEKQMTTVLDRNVHNIAINGTFDDCQDIVKAL
FADDDTNKALKLGAVNSINWARILAQIVYYFHSYFALANSSSSFKIGDKFRAVVPTGNFGDILAGYFAYRMGLPI
EKLVIATNENDILDRFWKTGKYEKNAARGVGVEGESVAEGTTNGEGGVRATLSPAMDILVSSNFERLLWYLAFEF
ASSAGMDYEWSKTQACQEVTAWLTELKKKGGFGPVYLDVLESARRTFESERVDDGQTVETIKKFYGDIGYVLDPH
TAVGVTAAERSIGRTGAHTPHISLSTAHPAKFSAAVNLALADKDGFDFEKMLPQEFVELSQRETRVDTVENSWEK
VREVVMKQVEEDLRE*
Coding >Hirsu2|3606
ATGTCCGACAGCGCGGCACGAGCAGCAACTCACAGCCCCTCGCAAACCTACCTGTCGACCCGGGGCGGCGACCAT
GGCTTATCTTTCGAGACCGTTGTGTTGAAGGGGCTTGCTGCCGACGGCGGCCTCTTCCTGCCCGAGGAAATCCCC
AAGGCCGCAGACTGGGAAAGCTGGAGCCATCTTTCGTATGCCGAACTCGCCTTTCGAATCCTCAGCCTCTACATC
TCCACCGACGAGATTCCTGCCAGCGATCTGAAAGCCATCATTGATCGAAGCTATTCGACATTCCGCGACAAGGAC
ATTACTCCTCTAAAACACCTGCGCGATAATTTATACCTACTCGAACTCTTCCATGGGCCGAGCTACTCCTTCAAA
GACTGCGCCCTGCAGTTCTTGGGCAATCTCTTTGAGTACTTTCTCGTCCGGAGAAATCAAGGGAAAGAGGGACGA
GAAAGGCACCATTTGACGGTCGTCGGCGCCACCAGCGGCGATACTGGATCCGCGGCAATATACGGTCTTCGGGGT
AAACAAGACGTCTCGGTTTTCATCCTTCATCCCAAGGGCCGCATCAGCCCGCTGCAGGAAAAGCAAATGACGACC
GTCCTGGACCGCAACGTTCACAACATAGCCATAAACGGCACGTTCGACGACTGCCAAGACATAGTCAAGGCGCTG
TTCGCTGATGACGACACGAACAAAGCGCTGAAACTCGGGGCCGTCAATTCTATCAACTGGGCCCGGATCCTGGCC
CAGATCGTCTACTACTTCCATTCGTACTTTGCCCTGGCCAATTCGTCGTCCTCTTTCAAGATTGGCGACAAATTC
CGAGCTGTGGTCCCCACCGGCAACTTTGGCGACATTCTGGCCGGGTATTTTGCCTATCGCATGGGTCTCCCCATC
GAAAAGCTTGTCATTGCAACCAACGAGAACGACATCCTAGACCGTTTCTGGAAGACCGGAAAGTACGAGAAGAAT
GCTGCTCGCGGTGTCGGGGTGGAGGGGGAATCGGTCGCCGAAGGCACCACCAACGGCGAGGGCGGCGTGCGGGCG
ACGCTGAGCCCGGCCATGGACATACTTGTCTCGAGCAACTTTGAGCGTCTTCTGTGGTACCTGGCTTTCGAGTTT
GCCTCAAGCGCCGGCATGGACTACGAATGGAGCAAGACGCAGGCCTGCCAGGAAGTCACGGCCTGGCTGACCGAG
CTGAAGAAGAAGGGAGGCTTCGGTCCCGTCTACCTGGACGTGCTCGAGAGCGCACGTCGGACATTCGAGAGCGAG
CGCGTCGACGACGGCCAGACGGTCGAGACCATCAAGAAGTTCTATGGCGACATCGGCTACGTCCTGGATCCCCAC
ACTGCCGTCGGTGTCACCGCCGCAGAAAGATCCATCGGCAGGACAGGCGCTCACACGCCACACATCTCCCTCTCG
ACTGCCCATCCCGCCAAGTTCTCGGCGGCCGTCAACCTGGCCCTGGCCGATAAGGACGGCTTCGACTTCGAAAAG
ATGCTTCCACAAGAGTTTGTCGAGCTGTCGCAAAGGGAAACGCGGGTGGATACAGTGGAGAACTCGTGGGAAAAG
GTGAGGGAGGTGGTGATGAAGCAGGTTGAGGAGGACCTGCGGGAGTAG
Transcript >Hirsu2|3606
ATGTCCGACAGCGCGGCACGAGCAGCAACTCACAGCCCCTCGCAAACCTACCTGTCGACCCGGGGCGGCGACCAT
GGCTTATCTTTCGAGACCGTTGTGTTGAAGGGGCTTGCTGCCGACGGCGGCCTCTTCCTGCCCGAGGAAATCCCC
AAGGCCGCAGACTGGGAAAGCTGGAGCCATCTTTCGTATGCCGAACTCGCCTTTCGAATCCTCAGCCTCTACATC
TCCACCGACGAGATTCCTGCCAGCGATCTGAAAGCCATCATTGATCGAAGCTATTCGACATTCCGCGACAAGGAC
ATTACTCCTCTAAAACACCTGCGCGATAATTTATACCTACTCGAACTCTTCCATGGGCCGAGCTACTCCTTCAAA
GACTGCGCCCTGCAGTTCTTGGGCAATCTCTTTGAGTACTTTCTCGTCCGGAGAAATCAAGGGAAAGAGGGACGA
GAAAGGCACCATTTGACGGTCGTCGGCGCCACCAGCGGCGATACTGGATCCGCGGCAATATACGGTCTTCGGGGT
AAACAAGACGTCTCGGTTTTCATCCTTCATCCCAAGGGCCGCATCAGCCCGCTGCAGGAAAAGCAAATGACGACC
GTCCTGGACCGCAACGTTCACAACATAGCCATAAACGGCACGTTCGACGACTGCCAAGACATAGTCAAGGCGCTG
TTCGCTGATGACGACACGAACAAAGCGCTGAAACTCGGGGCCGTCAATTCTATCAACTGGGCCCGGATCCTGGCC
CAGATCGTCTACTACTTCCATTCGTACTTTGCCCTGGCCAATTCGTCGTCCTCTTTCAAGATTGGCGACAAATTC
CGAGCTGTGGTCCCCACCGGCAACTTTGGCGACATTCTGGCCGGGTATTTTGCCTATCGCATGGGTCTCCCCATC
GAAAAGCTTGTCATTGCAACCAACGAGAACGACATCCTAGACCGTTTCTGGAAGACCGGAAAGTACGAGAAGAAT
GCTGCTCGCGGTGTCGGGGTGGAGGGGGAATCGGTCGCCGAAGGCACCACCAACGGCGAGGGCGGCGTGCGGGCG
ACGCTGAGCCCGGCCATGGACATACTTGTCTCGAGCAACTTTGAGCGTCTTCTGTGGTACCTGGCTTTCGAGTTT
GCCTCAAGCGCCGGCATGGACTACGAATGGAGCAAGACGCAGGCCTGCCAGGAAGTCACGGCCTGGCTGACCGAG
CTGAAGAAGAAGGGAGGCTTCGGTCCCGTCTACCTGGACGTGCTCGAGAGCGCACGTCGGACATTCGAGAGCGAG
CGCGTCGACGACGGCCAGACGGTCGAGACCATCAAGAAGTTCTATGGCGACATCGGCTACGTCCTGGATCCCCAC
ACTGCCGTCGGTGTCACCGCCGCAGAAAGATCCATCGGCAGGACAGGCGCTCACACGCCACACATCTCCCTCTCG
ACTGCCCATCCCGCCAAGTTCTCGGCGGCCGTCAACCTGGCCCTGGCCGATAAGGACGGCTTCGACTTCGAAAAG
ATGCTTCCACAAGAGTTTGTCGAGCTGTCGCAAAGGGAAACGCGGGTGGATACAGTGGAGAACTCGTGGGAAAAG
GTGAGGGAGGTGGTGATGAAGCAGGTTGAGGAGGACCTGCGGGAGTAG
Gene >Hirsu2|3606
ATGTCCGACAGCGCGGCACGAGCAGCAACTCACAGCCCCTCGCAAACCTACCTGTCGACCCGGGGCGGCGACCAT
GGCGTACGCTCTCCTCGGCATGCTTCTCTTTCCGCCCATCGTGACTGAATAGAGGCCAGTTATCTTTCGAGACCG
TTGTGTTGAAGGGGCTTGCTGCCGACGGCGGCCTCTTCCTGCCCGAGGAAATCCCCAAGGCCGCAGACTGGGTGC
GTACACGTTTCCCTCTCACCATGCCTCTTCTTCCCCGCAACTAACGCCGAGGACCGCCCTCAGGAAAGCTGGAGC
CATCTTTCGTATGCCGAACTCGCCTTTCGAATCCTCAGCCTCTACATCTCCACCGACGAGATTCCTGCCAGCGAT
CTGAAAGCCATCATTGATCGAAGCTATTCGACATTCCGCGACAAGGACATTACTCCTCTAAAACACCTGCGCGAT
AATTTATACCTACTCGAACTCTTCCATGGGCCGAGCTACTCCTTCAAAGACTGTACGGCGAACTGGAATCCTCCT
GATGGACTCCTGTCAAGGGTCGCACCTCCGTGCAAGCTGACCGATTGAAGGCGCCCTGCAGTTCTTGGGCAATCT
CTTTGAGTACTTTCTCGTCCGGAGAAATCAAGGGAAAGAGGGACGAGGTAAGCACTACATTCTTGGCCCAATCCA
GCATGAGTTGCCACGGATAGTGAGGGAGCCAAGGACTGACGAGCACACAGAAAGGCACCATTTGACGGTCGTCGG
CGCCACCAGCGGCGATGTAAATCCACCAATTCCCCAAGATCCTGGAACACGGTAATGCTGACATGCTGCCAGACT
GGATCCGCGGCAATATACGGTCTTCGGGGTAAACAAGACGTCTCGGTTTTCATCCTTCATCCCAAGGGCCGCATC
AGCCCGCTGCAGGAAAAGCAAATGACGACCGTCCTGGACCGCAACGTTCACAACATAGCCATAAACGGCACGTTC
GACGACTGCCAAGACATAGTCAAGGCGCTGTTCGCTGATGACGACACGAACAAAGCGCTGAAACTCGGGGCCGTC
AATTCTATCAACTGGGCCCGGATCCTGGCCCAGATCGTCTACTACTTCCATTCGTACTTTGCCCTGGCCAATTCG
TCGTCCTCTTTCAAGATTGGCGACAAATTCCGAGCTGTGGTCCCCACCGGCAACTTTGGCGACATTCTGGCCGGG
TATTTTGCCTATCGCATGGGTCTCCCCATCGAAAAGCTTGTCATTGCAACCAACGAGAACGACATCCTAGACCGT
TTCTGGAAGACCGGAAAGTACGAGAAGAATGCTGCTCGCGGTGTCGGGGTGGAGGGGGAATCGGTCGCCGAAGGC
ACCACCAACGGCGAGGGCGGCGTGCGGGCGACGCTGAGCCCGGCCATGGACATACTTGTCTCGAGCAACTTTGAG
CGTCTTCTGTGGTACCTGGCTTTCGAGTTTGCCTCAAGCGCCGGCATGGACTACGAATGGAGCAAGACGCAGGCC
TGCCAGGAAGTCACGGCCTGGCTGACCGAGCTGAAGAAGAAGGGAGGCTTCGGTCCCGTCTACCTGGACGTGCTC
GAGAGCGCACGTCGGACATTCGAGAGCGAGCGCGTCGACGACGGCCAGACGGTCGAGACCATCAAGAAGTTCTAT
GGCGACATCGGCTACGTCCTGGATCCCCACACTGCCGTCGGTGTCACCGCCGCAGAAAGATCCATCGGCAGGACA
GGCGCTCACACGCCACACATCTCCCTCTCGACTGCCCATCCCGCCAAGTTCTCGGCGGCCGTCAACCTGGCCCTG
GCCGATAAGGACGGCTTCGACTTCGAAAAGATGCTTCCACAAGAGTTTGTCGAGCTGTCGCAAAGGGAAACGCGG
GTGGATACAGTGGAGAACTCGTGGGAAAAGGTGAGGGAGGTGGTGATGAAGCAGGTTGAGGAGGACCTGCGGGAG
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail