Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3605
Gene name
LocationContig_196:18429..19228
Strand-
Gene length (bp)799
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00156 Pribosyltran Phosphoribosyl transferase domain 1.1E-07 13 127

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47165|XPT1_YEAST Xanthine phosphoribosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XPT1 PE=1 SV=1 3 199 1.0E-70
sp|O13917|HPRT_SCHPO Hypoxanthine-guanine phosphoribosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hpt1 PE=3 SV=1 4 197 3.0E-66
sp|Q04178|HPRT_YEAST Hypoxanthine-guanine phosphoribosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HPT1 PE=1 SV=1 3 193 6.0E-60

GO

GO Term Description Terminal node
GO:0009116 nucleoside metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3605
MVEKIYVTYNDVHKLCQRSADRLLADFKPQLMIAIGGGGYVPARILRSFLKQPGSPNIPIQAIGLSLYESLGGTE
VEAIGTKVTRTQWLDLTAIGEMENLVGKRVLIVDEVDDTRTTLEYAVKELEKDVEAARQRMGGDQPKTQFSIFVL
HNKDKPKKGTLPKEMVDRYYEAAETVGDVWINYPWEAIDIDEHDGRAQSAKA*
Coding >Hirsu2|3605
ATGGTTGAGAAAATCTACGTGACGTATAATGATGTCCACAAGCTGTGCCAGCGGTCCGCCGACCGGCTGCTCGCC
GACTTCAAGCCCCAGCTCATGATTGCCATCGGCGGCGGCGGCTACGTCCCTGCCCGCATCCTGCGCTCGTTCCTC
AAGCAGCCCGGCTCGCCCAACATCCCCATCCAGGCCATCGGCCTGTCGCTCTACGAGTCCCTCGGCGGCACCGAG
GTCGAGGCCATCGGCACAAAGGTCACCCGTACCCAATGGCTTGACCTGACTGCCATTGGCGAAATGGAGAACCTG
GTCGGCAAGCGCGTCCTCATCGTCGACGAGGTCGACGACACGCGGACGACGCTCGAGTATGCCGTCAAGGAGCTG
GAAAAGGACGTCGAGGCTGCCCGCCAGCGCATGGGCGGCGACCAGCCCAAAACCCAGTTCAGCATTTTTGTCCTT
CACAACAAGGACAAGCCCAAGAAAGGCACTCTGCCCAAGGAAATGGTCGATCGGTACTACGAGGCCGCCGAGACG
GTCGGCGACGTCTGGATCAATTATCCGTGGGAGGCCATCGACATCGACGAGCACGACGGACGGGCCCAAAGCGCC
AAGGCTTAA
Transcript >Hirsu2|3605
ATGGTTGAGAAAATCTACGTGACGTATAATGATGTCCACAAGCTGTGCCAGCGGTCCGCCGACCGGCTGCTCGCC
GACTTCAAGCCCCAGCTCATGATTGCCATCGGCGGCGGCGGCTACGTCCCTGCCCGCATCCTGCGCTCGTTCCTC
AAGCAGCCCGGCTCGCCCAACATCCCCATCCAGGCCATCGGCCTGTCGCTCTACGAGTCCCTCGGCGGCACCGAG
GTCGAGGCCATCGGCACAAAGGTCACCCGTACCCAATGGCTTGACCTGACTGCCATTGGCGAAATGGAGAACCTG
GTCGGCAAGCGCGTCCTCATCGTCGACGAGGTCGACGACACGCGGACGACGCTCGAGTATGCCGTCAAGGAGCTG
GAAAAGGACGTCGAGGCTGCCCGCCAGCGCATGGGCGGCGACCAGCCCAAAACCCAGTTCAGCATTTTTGTCCTT
CACAACAAGGACAAGCCCAAGAAAGGCACTCTGCCCAAGGAAATGGTCGATCGGTACTACGAGGCCGCCGAGACG
GTCGGCGACGTCTGGATCAATTATCCGTGGGAGGCCATCGACATCGACGAGCACGACGGACGGGCCCAAAGCGCC
AAGGCTTAA
Gene >Hirsu2|3605
ATGGTTGAGAAAATCTACGTGACGTATAATGATGTAGGTGCCATCGCCGCCCCTTGGCCTCGACCGCCCAGTGCA
ACTCGACCCATGCCGAGACGTGCCATCCAAGTGCGACCATCCGAGGCGGGAGGGCGGCTCTGACGACGTCTCGTA
GGTCCACAAGCTGTGCCAGCGGTCCGCCGACCGGCTGCTCGCCGACTTCAAGCCCCAGCTCATGATTGCCATCGG
CGGCGGCGGCTACGTCCCTGCCCGCATCCTGCGCTCGTTCCTCAAGCAGCCCGGCTCGCCCAACATCCCCATCCA
GGCCATCGGCCTGTCGCTCTACGAGTCCCTCGGCGGCACCGAGGTCGAGGCCATCGGCACAAAGGTCACCCGTAC
CCAATGGCTTGACCTGACTGCCATTGGCGAAATGGAGAACCTGGTCGGCAAGCGCGTCCTCATCGTCGACGAGGT
CGACGACACGCGGACGACGCTCGAGTATGCCGTCAAGGAGCTGGAAAAGGACGTCGAGGCTGCCCGCCAGCGCAT
GGGCGGCGACCAGCCCAAAACCCAGTTCAGCATTTTTGTCCTTCACGTATGCCGGCCGCTTGCCCCTCCCCATTC
TCCTGCCCCCCTCCACGATATGGCTCTGACCGGATTGGTATAGAACAAGGACAAGCCCAAGAAAGGCACTCTGCC
CAAGGAAATGGTCGATCGGTACTACGAGGCCGCCGAGACGGTCGGCGACGTCTGGATCAATTATCCGTGGGAGGC
CATCGACATCGACGAGCACGACGGACGGGCCCAAAGCGCCAAGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail