Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|360
Gene name
LocationContig_107:10956..14338
Strand+
Gene length (bp)3382
Transcript length (bp)3021
Coding sequence length (bp)3021
Protein length (aa) 1007

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01822 WSC WSC domain 6.5E-19 43 121
PF01822 WSC WSC domain 9.4E-19 148 228
PF01822 WSC WSC domain 3.6E-15 279 359
PF01822 WSC WSC domain 1.0E-18 388 472
PF07250 Glyoxal_oxid_N Glyoxal oxidase N-terminus 3.3E-24 551 752
PF09118 GO-like_E_set Galactose oxidase-like, Early set domain 2.5E-21 890 985

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 145 1006 0.0E+00
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 8 358 2.0E-46
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 25 235 3.0E-29
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 41 236 2.0E-26
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 39 235 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 145 1006 0.0E+00
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 8 358 2.0E-46
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 25 235 3.0E-29
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 41 236 2.0E-26
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 39 235 3.0E-22
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 279 481 5.0E-22
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 137 365 2.0E-21
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 137 367 1.0E-20
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 272 479 1.0E-17
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 42 240 2.0E-17
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 258 479 3.0E-17
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 42 240 8.0E-17
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 253 445 1.0E-15
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 42 240 1.0E-15
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 148 373 2.0E-15
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 42 129 2.0E-13
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 142 329 7.0E-13
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 33 200 8.0E-13
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 35 200 1.0E-12
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 15 200 2.0E-12
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 30 200 4.0E-12
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 136 244 8.0E-12
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 136 240 3.0E-11
sp|Q965Q8|XYLT_CAEEL Xylosyltransferase sqv-6 OS=Caenorhabditis elegans GN=sqv-6 PE=1 SV=3 148 259 1.0E-10
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 280 479 1.0E-10
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 148 244 3.0E-10
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 85 245 6.0E-10
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 85 245 8.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 280 479 9.0E-10
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 381 493 2.0E-09
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 280 442 6.0E-09
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 367 479 9.0E-09
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 43 131 9.0E-09
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 388 479 1.0E-08
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 43 131 1.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 390 479 1.0E-08
sp|Q5QQ52|XYLT_CAEBR Xylosyltransferase sqv-6 OS=Caenorhabditis briggsae GN=sqv-6 PE=2 SV=1 148 235 1.0E-08
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 388 479 1.0E-08
sp|Q924S4|KREM1_RAT Kremen protein 1 OS=Rattus norvegicus GN=Kremen1 PE=2 SV=1 45 130 2.0E-08
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 280 442 2.0E-08
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 280 366 3.0E-08
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 280 366 3.0E-08
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 45 130 3.0E-08
sp|Q99N43|KREM1_MOUSE Kremen protein 1 OS=Mus musculus GN=Kremen1 PE=2 SV=2 45 130 4.0E-08
sp|Q96MU8|KREM1_HUMAN Kremen protein 1 OS=Homo sapiens GN=KREMEN1 PE=2 SV=3 45 130 4.0E-08
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 45 130 6.0E-08
sp|Q924S4|KREM1_RAT Kremen protein 1 OS=Rattus norvegicus GN=Kremen1 PE=2 SV=1 280 366 7.0E-08
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 40 129 1.0E-07
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 280 448 1.0E-07
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 148 238 3.0E-07
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 371 479 3.0E-07
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 390 479 5.0E-07
sp|Q90Y90|KREM1_XENLA Kremen protein 1 OS=Xenopus laevis GN=kremen1 PE=2 SV=1 280 366 6.0E-07
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 375 479 8.0E-07
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 148 238 9.0E-07
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 364 479 9.0E-07
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 280 368 3.0E-06
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 280 368 4.0E-06
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 277 369 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|360
MAAPTRLSLISILIFYSLTPCEAGSLRRRDAVAPPSFDNGWKYQGCYVDVGRTLDGPSTADANMTNEKCASFCFS
KGYPYAGSEYHAECYCGSKLAPGGVKAAEKDCSDTCGGDASQPCGGAKRLTLYQTSQVSGPSVNPGVNGWASIGC
YSEGTTGRALTQGTNSVPEAQMTVAKCTAACTASGYILAGLEYGGECFCGNQISNGAQSVDTGCSMPCRGNSSEF
CGGSGRLNVYSLNGQLPSSTSMTYSRPRDVDPSSTTTGAISPVATGLPDGWASYGCWVDGVNGRILKYQAPDDPK
LTLQSCAKTCAGLGYSIAGAEYSRQCFCGNQIVNGGARAKSDSECNSACGGDGTQKCGGPGRMSIMSLGQPQVVG
PPQTIPSVGDWAYHGCVQDNVNQKRTFFWQNFFPSDLTPEACVKRCGDFGYMAAGMEYGRECYCGDPFNIETAGA
KVVSDKECNIPCAGNGSAICGGGSRLTTYFWKGDPFYSWTFPEAGSPEAGSYDFLIGGVCVPLMTSQAITGKVTF
LEKWGTGPPNSTGAYELDLSMLNDFKAAWRPMHVKTDIFCAGGLTLPDKAGRQLTVGGWSGSSTYGVRLYVPDGS
PGVPGKNDWQENVDVLKLQDGRWYPSAMNMANGSVLVIGGEVGSNGAPVPTLELLPPTGSKPLRMDWLERTDPNN
LYPFVCVLPSGGIFAAYWNEARILDENTFATIKTLPNMPGAVNDPKGGRTYPLEGTAVLLPQRAPYGDPLGVLIC
GGSTNGPANALDNCVSTYPDSPNPQWTLERMPSPRVMPCMAPLPDGTYMILNGARHGVAGFGLGKDPNLNALLYD
PAKPVGRRITVMANTTVARLYHSEAITLLDGRVLVSGSDPQDGVNPQEYRVETFTPPYLLRGKPRPTFSLADTDW
KYGQQVSFSLGGAAQNGDLSVSLLGSVSSTHGNSMGARTLFPEFSCSGTSCTVTAPPGKYICPPGWYQFFVLDGG
IPAVGVFVRIGGDPAQVGNWPQGNGFTRPGV*
Coding >Hirsu2|360
ATGGCGGCTCCAACAAGACTTTCCTTAATTTCTATTCTGATATTCTACTCACTTACCCCGTGCGAGGCTGGCTCT
CTTCGGAGACGTGATGCCGTGGCACCACCCTCCTTTGACAATGGCTGGAAGTATCAGGGCTGCTACGTCGACGTT
GGCCGGACCCTAGACGGCCCCAGCACTGCTGACGCGAACATGACAAACGAGAAATGCGCCAGCTTTTGCTTCAGC
AAAGGGTACCCCTACGCAGGCTCCGAATATCACGCTGAGTGCTATTGTGGCAGCAAGCTTGCCCCCGGTGGCGTC
AAGGCCGCCGAGAAGGACTGCAGTGACACGTGCGGAGGAGATGCCTCGCAACCCTGCGGCGGAGCGAAACGACTC
ACCTTATACCAAACGAGCCAAGTCTCCGGTCCGTCGGTGAACCCTGGGGTTAATGGTTGGGCTTCCATTGGCTGC
TATTCCGAAGGGACGACTGGCCGAGCATTGACGCAGGGAACCAACAGTGTCCCAGAGGCGCAGATGACCGTGGCC
AAGTGTACAGCTGCCTGCACAGCCTCCGGCTACATCCTCGCTGGACTCGAGTACGGAGGCGAATGCTTTTGCGGG
AACCAAATCTCCAACGGCGCACAGTCCGTGGACACGGGTTGCAGCATGCCTTGCAGGGGCAATAGCTCCGAGTTC
TGCGGTGGAAGCGGCCGCCTCAACGTGTACAGCTTGAACGGGCAGTTGCCCAGCAGTACGAGCATGACCTACAGC
CGCCCGCGCGATGTCGATCCCAGCAGCACTACAACAGGGGCCATATCCCCCGTGGCGACGGGGTTGCCAGACGGC
TGGGCCTCGTACGGGTGCTGGGTCGACGGAGTCAATGGGCGCATCCTGAAGTACCAGGCACCTGACGATCCGAAG
CTGACGCTCCAGTCTTGCGCGAAGACGTGCGCGGGCCTTGGCTACAGCATTGCCGGCGCCGAGTACTCGCGACAG
TGCTTCTGCGGCAACCAGATCGTCAACGGCGGCGCCCGGGCCAAGTCGGACTCGGAGTGCAACTCGGCCTGCGGC
GGTGACGGCACGCAGAAGTGCGGCGGGCCGGGCAGGATGAGCATCATGTCGCTGGGCCAGCCCCAGGTCGTCGGA
CCGCCGCAGACGATCCCCAGCGTCGGCGACTGGGCCTATCACGGCTGCGTCCAGGACAACGTCAACCAGAAGCGG
ACTTTTTTCTGGCAGAACTTCTTCCCGTCCGACCTGACGCCCGAGGCCTGCGTAAAACGGTGCGGCGACTTCGGT
TACATGGCGGCCGGCATGGAGTACGGCAGGGAGTGCTACTGTGGCGACCCGTTCAACATCGAGACGGCCGGTGCC
AAGGTCGTCAGCGACAAGGAGTGCAACATCCCCTGCGCCGGCAACGGGTCGGCCATCTGCGGCGGCGGCAGCCGT
CTGACGACGTACTTTTGGAAGGGCGACCCGTTCTACTCCTGGACCTTTCCCGAGGCCGGCTCGCCCGAGGCCGGC
TCGTACGACTTCCTCATCGGGGGCGTGTGCGTGCCGCTCATGACGTCCCAGGCCATCACCGGCAAGGTGACCTTC
CTGGAGAAATGGGGCACCGGCCCGCCCAATTCGACCGGTGCCTACGAGCTTGACCTGTCCATGCTCAACGACTTC
AAGGCGGCGTGGCGCCCGATGCACGTCAAGACGGACATCTTCTGCGCCGGCGGCCTCACCCTGCCGGACAAGGCC
GGCCGCCAGCTCACCGTGGGCGGCTGGTCGGGATCGTCGACGTACGGCGTTCGTCTGTACGTGCCCGACGGGTCG
CCCGGCGTGCCCGGCAAGAACGACTGGCAGGAGAACGTCGACGTGCTCAAGCTGCAGGACGGCCGCTGGTACCCG
TCGGCCATGAACATGGCCAACGGCTCCGTCCTCGTCATCGGCGGCGAGGTGGGCTCCAACGGCGCGCCGGTCCCG
ACGCTCGAGCTCCTCCCGCCGACGGGCAGCAAGCCGCTGCGCATGGACTGGCTCGAGCGGACCGACCCCAACAAC
CTGTACCCCTTTGTCTGCGTCCTCCCGTCCGGGGGCATCTTCGCTGCGTACTGGAACGAGGCGCGCATCCTCGAC
GAGAACACGTTTGCCACGATCAAGACGCTGCCCAACATGCCCGGCGCCGTCAACGACCCCAAGGGCGGCCGCACC
TATCCGCTCGAAGGAACGGCCGTCCTGCTTCCCCAGCGCGCGCCCTACGGCGACCCTCTGGGCGTTCTCATCTGC
GGCGGCTCGACCAACGGTCCGGCCAACGCGCTCGACAACTGCGTCAGCACCTATCCGGACTCGCCCAACCCCCAG
TGGACGCTCGAGCGCATGCCGTCGCCGCGCGTCATGCCCTGCATGGCCCCTCTCCCCGACGGCACCTACATGATC
CTCAACGGCGCCCGTCACGGCGTTGCCGGCTTCGGCCTGGGCAAGGACCCCAACCTCAACGCCCTGCTCTACGAC
CCGGCCAAGCCGGTCGGGCGGCGCATCACCGTCATGGCGAACACGACGGTGGCTCGCTTGTACCACTCCGAGGCC
ATCACGCTGCTCGACGGCCGGGTGCTCGTGTCGGGCTCCGACCCCCAAGACGGCGTCAACCCTCAGGAGTACCGC
GTCGAGACGTTCACGCCGCCTTACCTCCTCCGGGGCAAGCCTCGCCCGACCTTTTCGCTGGCCGACACGGACTGG
AAGTACGGACAGCAGGTGTCCTTTAGCCTTGGCGGCGCCGCGCAGAACGGCGACCTTTCCGTCTCGCTGCTCGGC
TCCGTCTCTAGCACCCACGGCAACTCGATGGGCGCCCGCACCCTGTTCCCGGAATTCTCGTGCTCCGGCACGTCC
TGTACCGTCACGGCGCCGCCCGGAAAGTACATCTGCCCGCCGGGCTGGTACCAGTTCTTCGTGCTCGATGGCGGG
ATTCCTGCCGTCGGCGTCTTCGTCCGGATCGGTGGAGATCCCGCCCAGGTCGGTAACTGGCCTCAGGGCAACGGC
TTCACCAGGCCCGGAGTGTGA
Transcript >Hirsu2|360
ATGGCGGCTCCAACAAGACTTTCCTTAATTTCTATTCTGATATTCTACTCACTTACCCCGTGCGAGGCTGGCTCT
CTTCGGAGACGTGATGCCGTGGCACCACCCTCCTTTGACAATGGCTGGAAGTATCAGGGCTGCTACGTCGACGTT
GGCCGGACCCTAGACGGCCCCAGCACTGCTGACGCGAACATGACAAACGAGAAATGCGCCAGCTTTTGCTTCAGC
AAAGGGTACCCCTACGCAGGCTCCGAATATCACGCTGAGTGCTATTGTGGCAGCAAGCTTGCCCCCGGTGGCGTC
AAGGCCGCCGAGAAGGACTGCAGTGACACGTGCGGAGGAGATGCCTCGCAACCCTGCGGCGGAGCGAAACGACTC
ACCTTATACCAAACGAGCCAAGTCTCCGGTCCGTCGGTGAACCCTGGGGTTAATGGTTGGGCTTCCATTGGCTGC
TATTCCGAAGGGACGACTGGCCGAGCATTGACGCAGGGAACCAACAGTGTCCCAGAGGCGCAGATGACCGTGGCC
AAGTGTACAGCTGCCTGCACAGCCTCCGGCTACATCCTCGCTGGACTCGAGTACGGAGGCGAATGCTTTTGCGGG
AACCAAATCTCCAACGGCGCACAGTCCGTGGACACGGGTTGCAGCATGCCTTGCAGGGGCAATAGCTCCGAGTTC
TGCGGTGGAAGCGGCCGCCTCAACGTGTACAGCTTGAACGGGCAGTTGCCCAGCAGTACGAGCATGACCTACAGC
CGCCCGCGCGATGTCGATCCCAGCAGCACTACAACAGGGGCCATATCCCCCGTGGCGACGGGGTTGCCAGACGGC
TGGGCCTCGTACGGGTGCTGGGTCGACGGAGTCAATGGGCGCATCCTGAAGTACCAGGCACCTGACGATCCGAAG
CTGACGCTCCAGTCTTGCGCGAAGACGTGCGCGGGCCTTGGCTACAGCATTGCCGGCGCCGAGTACTCGCGACAG
TGCTTCTGCGGCAACCAGATCGTCAACGGCGGCGCCCGGGCCAAGTCGGACTCGGAGTGCAACTCGGCCTGCGGC
GGTGACGGCACGCAGAAGTGCGGCGGGCCGGGCAGGATGAGCATCATGTCGCTGGGCCAGCCCCAGGTCGTCGGA
CCGCCGCAGACGATCCCCAGCGTCGGCGACTGGGCCTATCACGGCTGCGTCCAGGACAACGTCAACCAGAAGCGG
ACTTTTTTCTGGCAGAACTTCTTCCCGTCCGACCTGACGCCCGAGGCCTGCGTAAAACGGTGCGGCGACTTCGGT
TACATGGCGGCCGGCATGGAGTACGGCAGGGAGTGCTACTGTGGCGACCCGTTCAACATCGAGACGGCCGGTGCC
AAGGTCGTCAGCGACAAGGAGTGCAACATCCCCTGCGCCGGCAACGGGTCGGCCATCTGCGGCGGCGGCAGCCGT
CTGACGACGTACTTTTGGAAGGGCGACCCGTTCTACTCCTGGACCTTTCCCGAGGCCGGCTCGCCCGAGGCCGGC
TCGTACGACTTCCTCATCGGGGGCGTGTGCGTGCCGCTCATGACGTCCCAGGCCATCACCGGCAAGGTGACCTTC
CTGGAGAAATGGGGCACCGGCCCGCCCAATTCGACCGGTGCCTACGAGCTTGACCTGTCCATGCTCAACGACTTC
AAGGCGGCGTGGCGCCCGATGCACGTCAAGACGGACATCTTCTGCGCCGGCGGCCTCACCCTGCCGGACAAGGCC
GGCCGCCAGCTCACCGTGGGCGGCTGGTCGGGATCGTCGACGTACGGCGTTCGTCTGTACGTGCCCGACGGGTCG
CCCGGCGTGCCCGGCAAGAACGACTGGCAGGAGAACGTCGACGTGCTCAAGCTGCAGGACGGCCGCTGGTACCCG
TCGGCCATGAACATGGCCAACGGCTCCGTCCTCGTCATCGGCGGCGAGGTGGGCTCCAACGGCGCGCCGGTCCCG
ACGCTCGAGCTCCTCCCGCCGACGGGCAGCAAGCCGCTGCGCATGGACTGGCTCGAGCGGACCGACCCCAACAAC
CTGTACCCCTTTGTCTGCGTCCTCCCGTCCGGGGGCATCTTCGCTGCGTACTGGAACGAGGCGCGCATCCTCGAC
GAGAACACGTTTGCCACGATCAAGACGCTGCCCAACATGCCCGGCGCCGTCAACGACCCCAAGGGCGGCCGCACC
TATCCGCTCGAAGGAACGGCCGTCCTGCTTCCCCAGCGCGCGCCCTACGGCGACCCTCTGGGCGTTCTCATCTGC
GGCGGCTCGACCAACGGTCCGGCCAACGCGCTCGACAACTGCGTCAGCACCTATCCGGACTCGCCCAACCCCCAG
TGGACGCTCGAGCGCATGCCGTCGCCGCGCGTCATGCCCTGCATGGCCCCTCTCCCCGACGGCACCTACATGATC
CTCAACGGCGCCCGTCACGGCGTTGCCGGCTTCGGCCTGGGCAAGGACCCCAACCTCAACGCCCTGCTCTACGAC
CCGGCCAAGCCGGTCGGGCGGCGCATCACCGTCATGGCGAACACGACGGTGGCTCGCTTGTACCACTCCGAGGCC
ATCACGCTGCTCGACGGCCGGGTGCTCGTGTCGGGCTCCGACCCCCAAGACGGCGTCAACCCTCAGGAGTACCGC
GTCGAGACGTTCACGCCGCCTTACCTCCTCCGGGGCAAGCCTCGCCCGACCTTTTCGCTGGCCGACACGGACTGG
AAGTACGGACAGCAGGTGTCCTTTAGCCTTGGCGGCGCCGCGCAGAACGGCGACCTTTCCGTCTCGCTGCTCGGC
TCCGTCTCTAGCACCCACGGCAACTCGATGGGCGCCCGCACCCTGTTCCCGGAATTCTCGTGCTCCGGCACGTCC
TGTACCGTCACGGCGCCGCCCGGAAAGTACATCTGCCCGCCGGGCTGGTACCAGTTCTTCGTGCTCGATGGCGGG
ATTCCTGCCGTCGGCGTCTTCGTCCGGATCGGTGGAGATCCCGCCCAGGTCGGTAACTGGCCTCAGGGCAACGGC
TTCACCAGGCCCGGAGTGTGA
Gene >Hirsu2|360
ATGGCGGCTCCAACAAGACTTTCCTTAATTTCTATTCTGATATTCTACTCACTTACCCCGTGCGAGGCTGGCTCT
CTTCGGAGACGTGATGCCGTGGCACCACCCTCCTTTGACAATGGCTGGAAGTATCAGGGCTGCTACGTGTACCGA
CTCCCTCCTCGACTTGACTGCTTCTTCCGGCTCGCAATAGACTGACGAGGGAATAGCGACGTTGGCCGGACCCTA
GACGGCCCCAGCACTGCTGACGCGAACATGACAAACGAGAAATGCGCCAGCTTTTGCTTCAGCAAAGGGTACCCC
TACGCAGGCTCCGAATATCACGCTGAGTGCTATTGTGGCAGCAAGCTTGCCCCCGGTGGCGTCAAGGCCGCCGAG
AAGGACTGCAGTGACACGTGCGGAGGAGATGCCTCGCAACCCTGCGGCGGAGCGAAACGACTCACCTTATACCAA
ACGAGCCAAGTCTCCGGTCCGTCGGTGAACCCTGGGGTTAATGGTTGGGCTTCCATTGGCTGCTATTCGTGAGTT
CCTGGCTCCTTTTGTGCGCTTGTCTTTCTCTGCCTCTCGATCCGTTCCGCACGATCTTGACTTGTTTCTCTTCCG
ACGTCTTCTCCCGTTCAAGAGACGAGTGACCTGGCTGACTCAACTGCTCAGCGAAGGGACGACTGGCCGAGCATT
GACGCAGGGAACCAACAGTGTCCCAGAGGCGCAGATGACCGTGGCCAAGTGTACAGCTGCCTGCACAGCCTCCGG
CTACATCCTCGCTGGACTCGAGTACGGAGGCGAATGCTGTAAGTACAGGCCGATAAGGCGGAACAAGCTCCAATC
GGGAGAGGAATACTAATCGTTGCCTGTGCGTGCAGTTTGCGGGAACCAAATCTCCAACGGCGCACAGTCCGTGGA
CACGGGTTGCAGCATGCCTTGCAGGGGCAATAGCTCCGAGTTCTGCGGTGGAAGCGGCCGCCTCAACGTGTACAG
CTTGAACGGGCAGTTGCCCAGCAGTACGAGGTGCGTGGGAACGGCCTGGGGATGCCGAGGAGGCTGTCAGATGTC
ACCTGTGTGAGCTGGGATATTCGATGCTAACGAATAGCGCCGCATGAGCATGACCTACAGCCGCCCGCGCGATGT
CGATCCCAGCAGCACTACAACAGGGGCCATATCCCCCGTGGCGACGGGGTTGCCAGACGGCTGGGCCTCGTACGG
GTGCTGGGTCGACGGAGTCAATGGGCGCATCCTGAAGTACCAGGCACCTGACGATCCGAAGCTGACGCTCCAGTC
TTGCGCGAAGACGTGCGCGGGCCTTGGCTACAGCATTGCCGGCGCCGAGTACTCGCGACAGTGCTTCTGCGGCAA
CCAGATCGTCAACGGCGGCGCCCGGGCCAAGTCGGACTCGGAGTGCAACTCGGCCTGCGGCGGTGACGGCACGCA
GAAGTGCGGCGGGCCGGGCAGGATGAGCATCATGTCGCTGGGCCAGCCCCAGGTCGTCGGACCGCCGCAGACGAT
CCCCAGCGTCGGCGACTGGGCCTATCACGGCTGCGTCCAGGACAACGTCAACCAGAAGCGGACTTTTTTCTGGCA
GAACTTCTTCCCGTCCGACCTGACGCCCGAGGCCTGCGTAAAACGGTGCGGCGACTTCGGTTACATGGCGGCCGG
CATGGAGTACGGCAGGGAGTGCTACTGTGGCGACCCGTTCAACATCGAGACGGCCGGTGCCAAGGTCGTCAGCGA
CAAGGAGTGCAACATCCCCTGCGCCGGCAACGGGTCGGCCATCTGCGGCGGCGGCAGCCGTCTGACGACGTACTT
TTGGAAGGGCGACCCGTTCTACTCCTGGACCTTTCCCGAGGCCGGCTCGCCCGAGGCCGGCTCGTACGACTTCCT
CATCGGGGGCGTGTGCGTGCCGCTCATGACGTCCCAGGCCATCACCGGCAAGGTGACCTTCCTGGAGAAATGGGG
CACCGGCCCGCCCAATTCGACCGGTGCCTACGAGCTTGACCTGTCCATGCTCAACGACTTCAAGGCGGCGTGGCG
CCCGATGCACGTCAAGACGGACATCTTCTGCGCCGGCGGCCTCACCCTGCCGGACAAGGCCGGCCGCCAGCTCAC
CGTGGGCGGCTGGTCGGGATCGTCGACGTACGGCGTTCGTCTGTACGTGCCCGACGGGTCGCCCGGCGTGCCCGG
CAAGAACGACTGGCAGGAGAACGTCGACGTGCTCAAGCTGCAGGACGGCCGCTGGTACCCGTCGGCCATGAACAT
GGCCAACGGCTCCGTCCTCGTCATCGGCGGCGAGGTGGGCTCCAACGGCGCGCCGGTCCCGACGCTCGAGCTCCT
CCCGCCGACGGGCAGCAAGCCGCTGCGCATGGACTGGCTCGAGCGGACCGACCCCAACAACCTGTACCCCTTTGT
CTGCGTCCTCCCGTCCGGGGGCATCTTCGCTGCGTACTGGAACGAGGCGCGCATCCTCGACGAGAACACGTTTGC
CACGATCAAGACGCTGCCCAACATGCCCGGCGCCGTCAACGACCCCAAGGGCGGCCGCACCTATCCGCTCGAAGG
AACGGCCGTCCTGCTTCCCCAGCGCGCGCCCTACGGCGACCCTCTGGGCGTTCTCATCTGCGGCGGCTCGACCAA
CGGTCCGGCCAACGCGCTCGACAACTGCGTCAGCACCTATCCGGACTCGCCCAACCCCCAGTGGACGCTCGAGCG
CATGCCGTCGCCGCGCGTCATGCCCTGCATGGCCCCTCTCCCCGACGGCACCTACATGATCCTCAACGGCGCCCG
TCACGGCGTTGCCGGCTTCGGCCTGGGCAAGGACCCCAACCTCAACGCCCTGCTCTACGACCCGGCCAAGCCGGT
CGGGCGGCGCATCACCGTCATGGCGAACACGACGGTGGCTCGCTTGTACCACTCCGAGGCCATCACGCTGCTCGA
CGGCCGGGTGCTCGTGTCGGGCTCCGACCCCCAAGACGGCGTCAACCCTCAGGAGTACCGCGTCGAGACGTTCAC
GCCGCCTTACCTCCTCCGGGGCAAGCCTCGCCCGACCTTTTCGCTGGCCGACACGGACTGGAAGTACGGACAGCA
GGTGTCCTTTAGCCTTGGCGGCGCCGCGCAGAACGGCGACCTTTCCGTCTCGCTGCTCGGCTCCGTCTCTAGCAC
CCACGGCAACTCGATGGGCGCCCGCACCCTGTTCCCGGAATTCTCGTGCTCCGGCACGTCCTGTACCGTCACGGC
GCCGCCCGGAAAGTACATCTGCCCGCCGGGCTGGTACCAGTTCTTCGTGCTCGATGGCGGGATTCCTGCCGTCGG
CGTCTTCGTCCGGATCGGTGGAGATCCCGCCCAGGTCGGTAACTGGCCTCAGGGCAACGGCTTCACCAGGCCCGG
AGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail