Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3595
Gene name
LocationContig_1958:2706..3987
Strand-
Gene length (bp)1281
Transcript length (bp)1281
Coding sequence length (bp)1281
Protein length (aa) 427

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13855 LRR_8 Leucine rich repeat 3.1E-07 12 70

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 22 206 2.0E-27
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 12 155 2.0E-10
sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 9 170 2.0E-10
sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 9 149 8.0E-10
sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 26 156 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG2|YFT6_SCHPO Uncharacterized leucine-rich repeat-containing protein C926.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.06c PE=1 SV=1 22 206 2.0E-27
sp|Q8CDN9|LRRC9_MOUSE Leucine-rich repeat-containing protein 9 OS=Mus musculus GN=Lrrc9 PE=1 SV=2 12 155 2.0E-10
sp|Q5F479|S11IP_CHICK Serine/threonine-protein kinase 11-interacting protein OS=Gallus gallus GN=STK11IP PE=2 SV=1 9 170 2.0E-10
sp|Q6IRN0|S11IP_XENLA Serine/threonine-protein kinase 11-interacting protein OS=Xenopus laevis GN=stk11ip PE=2 SV=1 9 149 8.0E-10
sp|Q9Y2I1|NISCH_HUMAN Nischarin OS=Homo sapiens GN=NISCH PE=1 SV=3 26 156 9.0E-10
sp|Q4G017|NISCH_RAT Nischarin OS=Rattus norvegicus GN=Nisch PE=2 SV=2 26 156 1.0E-09
sp|Q80TM9|NISCH_MOUSE Nischarin OS=Mus musculus GN=Nisch PE=1 SV=2 26 156 3.0E-09
sp|Q6ZRR7|LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens GN=LRRC9 PE=2 SV=2 12 155 4.0E-09
sp|Q8NEP3|DAAF1_HUMAN Dynein assembly factor 1, axonemal OS=Homo sapiens GN=DNAAF1 PE=1 SV=5 7 152 7.0E-09
sp|Q6P4K6|S11IP_XENTR Serine/threonine-protein kinase 11-interacting protein OS=Xenopus tropicalis GN=stk11ip PE=2 SV=1 9 149 2.0E-08
sp|Q8N1F8|S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens GN=STK11IP PE=1 SV=3 37 151 4.0E-08
sp|Q3SYS4|DAAF1_BOVIN Dynein assembly factor 1, axonemal OS=Bos taurus GN=DNAAF1 PE=2 SV=2 7 149 1.0E-07
sp|A0JM56|LRRC9_XENTR Leucine-rich repeat-containing protein 9 OS=Xenopus tropicalis GN=lrrc9 PE=2 SV=2 12 143 3.0E-07
sp|Q09JZ4|DAAF1_CHLRE Leucine-rich repeat-containing protein ODA7 OS=Chlamydomonas reinhardtii GN=ODA7 PE=1 SV=1 12 149 1.0E-06
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 12 139 2.0E-06
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 12 139 2.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 12 139 3.0E-06
sp|Q3TAA7|S11IP_MOUSE Serine/threonine-protein kinase 11-interacting protein OS=Mus musculus GN=Stk11ip PE=1 SV=1 40 151 5.0E-06
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 12 139 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7464 0.4645 0.0448 0.0772 0.082 0.0067 0.124 0.0722 0.1854 0.047

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2487
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6227
Ophiocordyceps australis map64 (Brazil) OphauB2|4091
Ophiocordyceps camponoti-floridani Ophcf2|04489
Ophiocordyceps camponoti-rufipedis Ophun1|972
Ophiocordyceps kimflemingae Ophio5|1598
Ophiocordyceps subramaniannii Hirsu2|3595 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3595
MGILPASKWRFLRHLSLADNAMTSIPLASLAPLSNTLFSLDLSSNLFSQIPDSLATLTALRALNLSHCMIDSLHS
LVRSPLPAITALNLRANRLQSLAGVEKLYPLERLDLRDNQLADPLELARLTGIPDLREIWVEGNPFARTHKDHRV
AIFNLFRATPGYTVDPLIDGHGPTYSERRLLLDRAPIPDSVPVVKPKPSSSEAPAVVDVGKPTIVYGAAATTRES
GGGLLRKERPVAKTVTSEVGAGSGRRRKSNKRRIVDLARGDAALALPPLAVDVARPEPLRAAAPPPDDSPTGNYR
ISRPTESLLLPPVTLSESRREVPSTVAAAADVDLVLSCASRESADPAAGMDPQDWDVGGEIYRRKIQTLRDRVGS
GYLSVLSEESWDGTGSFNAGSSPSVPPLRAGHLSNHSLAPPQAVHSGRTVG*
Coding >Hirsu2|3595
ATGGGCATCCTGCCCGCCTCCAAGTGGCGCTTTCTGCGTCACCTCAGCCTCGCCGACAACGCCATGACCTCGATC
CCGCTCGCCAGCCTCGCGCCCCTCTCCAACACCCTCTTCTCCCTCGACCTCTCCTCCAACCTCTTCAGCCAGATC
CCCGACAGCCTGGCCACCCTCACCGCCCTCCGCGCCCTCAACCTGTCGCACTGCATGATCGACTCGCTCCACTCC
CTCGTCCGCAGCCCGCTGCCGGCCATCACCGCCCTCAACCTGCGCGCCAACCGCCTGCAGTCGCTCGCCGGCGTC
GAGAAGCTGTACCCGCTCGAGCGCCTGGACCTGCGCGACAACCAGCTGGCCGACCCCCTCGAGCTGGCCCGCCTG
ACCGGCATCCCCGACCTGCGCGAGATCTGGGTCGAGGGCAACCCCTTCGCCCGCACCCACAAGGACCACCGCGTC
GCCATCTTCAACCTGTTCCGCGCCACGCCCGGCTACACCGTCGACCCCCTCATCGACGGCCACGGGCCCACCTAC
TCGGAGCGCCGGCTGCTCCTCGACCGCGCCCCCATCCCGGACTCGGTGCCCGTCGTCAAGCCCAAGCCGTCGTCG
TCCGAGGCCCCCGCCGTCGTCGACGTCGGTAAGCCCACCATCGTCTACGGCGCCGCCGCCACCACCCGGGAGTCG
GGCGGCGGCCTGCTGCGCAAGGAGAGGCCCGTCGCCAAGACGGTGACGAGCGAGGTGGGCGCCGGCTCGGGCCGC
CGCCGCAAGTCGAACAAGAGGCGCATCGTCGACCTGGCCAGGGGCGACGCCGCGCTCGCGCTCCCCCCCCTGGCC
GTCGACGTGGCGCGTCCGGAGCCCCTGCGCGCGGCCGCCCCCCCTCCCGACGACTCCCCGACCGGCAACTATCGC
ATCTCCCGCCCGACCGAGTCTCTCCTGCTGCCGCCCGTGACGCTGTCCGAGAGCCGCAGGGAGGTGCCGTCCACC
GTCGCCGCCGCCGCCGACGTCGATCTCGTGCTGTCCTGCGCGTCGCGCGAATCCGCCGACCCGGCCGCCGGCATG
GACCCTCAGGACTGGGACGTCGGCGGCGAGATCTACCGGCGCAAGATCCAGACGCTGCGGGACCGCGTCGGCAGC
GGCTACCTCAGCGTCCTCAGCGAGGAGAGCTGGGACGGCACGGGCAGCTTCAACGCGGGCAGCTCGCCCTCGGTC
CCGCCCCTGCGCGCCGGCCACCTCTCGAACCACAGCCTGGCCCCTCCCCAGGCGGTCCACAGCGGACGCACCGTC
GGCTGA
Transcript >Hirsu2|3595
ATGGGCATCCTGCCCGCCTCCAAGTGGCGCTTTCTGCGTCACCTCAGCCTCGCCGACAACGCCATGACCTCGATC
CCGCTCGCCAGCCTCGCGCCCCTCTCCAACACCCTCTTCTCCCTCGACCTCTCCTCCAACCTCTTCAGCCAGATC
CCCGACAGCCTGGCCACCCTCACCGCCCTCCGCGCCCTCAACCTGTCGCACTGCATGATCGACTCGCTCCACTCC
CTCGTCCGCAGCCCGCTGCCGGCCATCACCGCCCTCAACCTGCGCGCCAACCGCCTGCAGTCGCTCGCCGGCGTC
GAGAAGCTGTACCCGCTCGAGCGCCTGGACCTGCGCGACAACCAGCTGGCCGACCCCCTCGAGCTGGCCCGCCTG
ACCGGCATCCCCGACCTGCGCGAGATCTGGGTCGAGGGCAACCCCTTCGCCCGCACCCACAAGGACCACCGCGTC
GCCATCTTCAACCTGTTCCGCGCCACGCCCGGCTACACCGTCGACCCCCTCATCGACGGCCACGGGCCCACCTAC
TCGGAGCGCCGGCTGCTCCTCGACCGCGCCCCCATCCCGGACTCGGTGCCCGTCGTCAAGCCCAAGCCGTCGTCG
TCCGAGGCCCCCGCCGTCGTCGACGTCGGTAAGCCCACCATCGTCTACGGCGCCGCCGCCACCACCCGGGAGTCG
GGCGGCGGCCTGCTGCGCAAGGAGAGGCCCGTCGCCAAGACGGTGACGAGCGAGGTGGGCGCCGGCTCGGGCCGC
CGCCGCAAGTCGAACAAGAGGCGCATCGTCGACCTGGCCAGGGGCGACGCCGCGCTCGCGCTCCCCCCCCTGGCC
GTCGACGTGGCGCGTCCGGAGCCCCTGCGCGCGGCCGCCCCCCCTCCCGACGACTCCCCGACCGGCAACTATCGC
ATCTCCCGCCCGACCGAGTCTCTCCTGCTGCCGCCCGTGACGCTGTCCGAGAGCCGCAGGGAGGTGCCGTCCACC
GTCGCCGCCGCCGCCGACGTCGATCTCGTGCTGTCCTGCGCGTCGCGCGAATCCGCCGACCCGGCCGCCGGCATG
GACCCTCAGGACTGGGACGTCGGCGGCGAGATCTACCGGCGCAAGATCCAGACGCTGCGGGACCGCGTCGGCAGC
GGCTACCTCAGCGTCCTCAGCGAGGAGAGCTGGGACGGCACGGGCAGCTTCAACGCGGGCAGCTCGCCCTCGGTC
CCGCCCCTGCGCGCCGGCCACCTCTCGAACCACAGCCTGGCCCCTCCCCAGGCGGTCCACAGCGGACGCACCGTC
GGCTGA
Gene >Hirsu2|3595
ATGGGCATCCTGCCCGCCTCCAAGTGGCGCTTTCTGCGTCACCTCAGCCTCGCCGACAACGCCATGACCTCGATC
CCGCTCGCCAGCCTCGCGCCCCTCTCCAACACCCTCTTCTCCCTCGACCTCTCCTCCAACCTCTTCAGCCAGATC
CCCGACAGCCTGGCCACCCTCACCGCCCTCCGCGCCCTCAACCTGTCGCACTGCATGATCGACTCGCTCCACTCC
CTCGTCCGCAGCCCGCTGCCGGCCATCACCGCCCTCAACCTGCGCGCCAACCGCCTGCAGTCGCTCGCCGGCGTC
GAGAAGCTGTACCCGCTCGAGCGCCTGGACCTGCGCGACAACCAGCTGGCCGACCCCCTCGAGCTGGCCCGCCTG
ACCGGCATCCCCGACCTGCGCGAGATCTGGGTCGAGGGCAACCCCTTCGCCCGCACCCACAAGGACCACCGCGTC
GCCATCTTCAACCTGTTCCGCGCCACGCCCGGCTACACCGTCGACCCCCTCATCGACGGCCACGGGCCCACCTAC
TCGGAGCGCCGGCTGCTCCTCGACCGCGCCCCCATCCCGGACTCGGTGCCCGTCGTCAAGCCCAAGCCGTCGTCG
TCCGAGGCCCCCGCCGTCGTCGACGTCGGTAAGCCCACCATCGTCTACGGCGCCGCCGCCACCACCCGGGAGTCG
GGCGGCGGCCTGCTGCGCAAGGAGAGGCCCGTCGCCAAGACGGTGACGAGCGAGGTGGGCGCCGGCTCGGGCCGC
CGCCGCAAGTCGAACAAGAGGCGCATCGTCGACCTGGCCAGGGGCGACGCCGCGCTCGCGCTCCCCCCCCTGGCC
GTCGACGTGGCGCGTCCGGAGCCCCTGCGCGCGGCCGCCCCCCCTCCCGACGACTCCCCGACCGGCAACTATCGC
ATCTCCCGCCCGACCGAGTCTCTCCTGCTGCCGCCCGTGACGCTGTCCGAGAGCCGCAGGGAGGTGCCGTCCACC
GTCGCCGCCGCCGCCGACGTCGATCTCGTGCTGTCCTGCGCGTCGCGCGAATCCGCCGACCCGGCCGCCGGCATG
GACCCTCAGGACTGGGACGTCGGCGGCGAGATCTACCGGCGCAAGATCCAGACGCTGCGGGACCGCGTCGGCAGC
GGCTACCTCAGCGTCCTCAGCGAGGAGAGCTGGGACGGCACGGGCAGCTTCAACGCGGGCAGCTCGCCCTCGGTC
CCGCCCCTGCGCGCCGGCCACCTCTCGAACCACAGCCTGGCCCCTCCCCAGGCGGTCCACAGCGGACGCACCGTC
GGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail