Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3591
Gene name
LocationContig_1955:1828..3821
Strand+
Gene length (bp)1993
Transcript length (bp)1827
Coding sequence length (bp)1827
Protein length (aa) 609

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04762 IKI3 IKI3 family 7.2E-144 17 400

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59704|ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iki3 PE=3 SV=1 25 604 1.0E-132
sp|Q06706|ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI3 PE=1 SV=1 65 605 6.0E-120
sp|Q8VHU4|ELP1_RAT Elongator complex protein 1 OS=Rattus norvegicus GN=Ikbkap PE=2 SV=1 41 598 2.0E-82
sp|Q7TT37|ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus GN=Ikbkap PE=1 SV=2 41 573 3.0E-82
sp|Q8WND5|ELP1_RABIT Elongator complex protein 1 OS=Oryctolagus cuniculus GN=IKBKAP PE=2 SV=1 44 591 5.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59704|ELP1_SCHPO Elongator complex protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iki3 PE=3 SV=1 25 604 1.0E-132
sp|Q06706|ELP1_YEAST Elongator complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI3 PE=1 SV=1 65 605 6.0E-120
sp|Q8VHU4|ELP1_RAT Elongator complex protein 1 OS=Rattus norvegicus GN=Ikbkap PE=2 SV=1 41 598 2.0E-82
sp|Q7TT37|ELP1_MOUSE Elongator complex protein 1 OS=Mus musculus GN=Ikbkap PE=1 SV=2 41 573 3.0E-82
sp|Q8WND5|ELP1_RABIT Elongator complex protein 1 OS=Oryctolagus cuniculus GN=IKBKAP PE=2 SV=1 44 591 5.0E-79
sp|Q2TAQ1|ELP1_XENLA Putative elongator complex protein 1 OS=Xenopus laevis GN=ikbkap PE=2 SV=1 46 565 3.0E-77
sp|O95163|ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens GN=IKBKAP PE=1 SV=3 44 593 3.0E-74
sp|Q9VGK7|ELP1_DROME Putative elongator complex protein 1 OS=Drosophila melanogaster GN=Elp1 PE=1 SV=2 82 596 4.0E-64
sp|Q9FNA4|ELP1_ARATH Elongator complex protein 1 OS=Arabidopsis thaliana GN=ELP1 PE=1 SV=1 48 572 2.0E-51
[Show less]

GO

GO Term Description Terminal node
GO:0002098 tRNA wobble uridine modification Yes
GO:0033588 elongator holoenzyme complex Yes
GO:0006807 nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0140535 intracellular protein-containing complex No
GO:0006400 tRNA modification No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0032991 protein-containing complex No
GO:0043412 macromolecule modification No
GO:0009451 RNA modification No
GO:0090304 nucleic acid metabolic process No
GO:0016070 RNA metabolic process No
GO:0006399 tRNA metabolic process No
GO:0044238 primary metabolic process No
GO:0034470 ncRNA processing No
GO:0008033 tRNA processing No
GO:0002097 tRNA wobble base modification No
GO:0006725 cellular aromatic compound metabolic process No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0006396 RNA processing No
GO:0043170 macromolecule metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6723 0.6912 0.0168 0.1035 0.0577 0.0031 0.2528 0.4015 0.3791 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2486
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4176
Ophiocordyceps australis map64 (Brazil) OphauB2|6261
Ophiocordyceps camponoti-floridani Ophcf2|04330
Ophiocordyceps camponoti-rufipedis Ophun1|3727
Ophiocordyceps kimflemingae Ophio5|1610
Ophiocordyceps subramaniannii Hirsu2|3591 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3591
MDILADNLNFASISTFEDDTSTEGYGQDLSGNLYKLSKSYSEPLPIRFPSHLPWFDVSKPEAAPLAFGLSRKGHI
YANTKLLAKNCTSFVVTPSHLIFTTSNHFIKYVHLAPDVHDLEVPEDDPEKDERCRSVERGSRLVAAIPTNMSIV
LQMPRGNVETIFPRAMVVAGVRDLIGQGNYGRAFSYCRTQRVDMNILCDHKPEQFLASIGSFLNQLKEVAHIDLF
LSSLREEDVTQTMYSDTKCRPTQQNPNHAENGSSAFVWPTGTKVKTVCDALLNSLQSRKGADLQNIITAHVCKIP
PALDDSLTLVAELMQEDENVAEKAIEHICFLVDVNRVYDNALGLYNLDLALLVAQQSQRDPREYLPYIQNLHTLP
EVRRKFEIDDHLGCRSKALKHLHVLGEFDELCRYTTKHVLYQDALRLYRYEEPRLRILTDLYAAHLESKSAFREA
GVAHESLQNYAKATSCYRAAGATCWQECLYTAQQQSPGLSDDAMSDLATSLADALWEAKDYSAAATIHLEYLSSL
ETAVKCLCKGYNFAEAIRLVVQRGRPDLLEAAVDVGLAEALGSTTEFLADCKGQLDAQVPRIAELRRRAAEDPLA
FYEGEPRV*
Coding >Hirsu2|3591
ATGGATATTCTGGCAGACAATCTGAACTTTGCATCTATCTCCACTTTCGAGGATGACACATCAACAGAAGGCTAC
GGTCAGGACCTCTCAGGAAATCTCTACAAGCTGTCAAAGTCGTATTCGGAGCCGCTGCCCATTCGATTTCCATCG
CATCTCCCCTGGTTTGACGTTAGCAAGCCAGAAGCCGCCCCTCTGGCTTTCGGCCTTTCAAGAAAGGGCCACATT
TACGCCAATACAAAGCTGCTGGCCAAGAACTGCACCTCGTTCGTGGTCACCCCGAGCCATCTCATTTTTACGACC
AGTAATCACTTTATCAAGTATGTGCACTTGGCTCCTGATGTTCACGATCTGGAAGTTCCGGAAGACGACCCGGAG
AAGGACGAAAGATGCCGTAGTGTCGAACGCGGCTCTCGTTTGGTTGCTGCTATTCCCACAAACATGAGCATTGTT
TTGCAGATGCCAAGAGGGAATGTCGAAACCATCTTCCCACGTGCCATGGTCGTTGCCGGGGTCCGTGACCTCATC
GGCCAGGGAAACTATGGTCGAGCCTTCTCATATTGCCGTACCCAGCGTGTCGACATGAATATTCTGTGTGACCAT
AAGCCCGAGCAGTTCCTGGCTAGCATTGGATCGTTCTTGAACCAGCTTAAAGAGGTAGCGCATATTGACCTCTTC
CTGTCATCTTTGAGAGAGGAGGACGTAACTCAGACCATGTATTCGGACACCAAGTGTCGACCTACGCAACAAAAC
CCAAACCACGCAGAAAACGGCAGTTCTGCGTTCGTGTGGCCCACCGGCACCAAAGTCAAAACCGTGTGCGACGCC
CTGCTAAACAGTCTTCAATCTCGCAAGGGCGCCGACCTTCAGAACATCATCACTGCGCACGTGTGTAAGATCCCG
CCTGCTCTGGACGACAGTCTGACCCTCGTCGCCGAGTTGATGCAGGAGGACGAGAACGTAGCGGAGAAGGCGATT
GAGCACATCTGCTTTCTGGTGGATGTCAACCGGGTCTATGACAACGCGCTCGGACTGTACAACCTTGACCTCGCC
TTGTTGGTTGCGCAGCAATCACAGCGAGATCCTCGAGAATACCTGCCTTACATTCAGAACCTCCACACCCTGCCT
GAGGTGCGCCGCAAGTTCGAGATCGATGACCACCTTGGTTGCCGGTCGAAGGCCCTGAAACACCTCCACGTGCTG
GGCGAGTTCGACGAACTCTGCCGCTACACCACCAAGCATGTGCTATACCAGGACGCCCTCAGACTCTATCGCTAC
GAAGAGCCTCGACTGCGAATCTTAACCGATCTATACGCCGCTCACCTGGAATCTAAGTCGGCTTTCCGCGAGGCC
GGTGTTGCTCATGAGTCTCTCCAGAATTATGCAAAGGCGACAAGTTGCTACCGCGCAGCCGGTGCCACGTGCTGG
CAAGAATGCCTCTATACGGCCCAACAGCAGTCTCCCGGTCTCTCCGACGACGCCATGTCCGATCTGGCCACGAGC
TTGGCTGATGCTCTCTGGGAAGCCAAGGACTACAGCGCTGCTGCGACCATCCACCTTGAGTATCTGTCGTCCCTC
GAGACGGCTGTCAAATGCCTCTGCAAGGGCTACAATTTCGCCGAGGCCATCCGCCTCGTTGTCCAGCGAGGCCGC
CCTGACCTCCTCGAGGCGGCCGTCGACGTGGGTCTCGCGGAAGCCCTAGGCAGCACGACCGAGTTTCTCGCCGAC
TGCAAAGGCCAGCTCGACGCGCAGGTGCCCCGCATCGCCGAGCTGCGTCGCAGGGCAGCTGAGGACCCGCTGGCT
TTCTACGAGGGCGAGCCTCGCGTTTGA
Transcript >Hirsu2|3591
ATGGATATTCTGGCAGACAATCTGAACTTTGCATCTATCTCCACTTTCGAGGATGACACATCAACAGAAGGCTAC
GGTCAGGACCTCTCAGGAAATCTCTACAAGCTGTCAAAGTCGTATTCGGAGCCGCTGCCCATTCGATTTCCATCG
CATCTCCCCTGGTTTGACGTTAGCAAGCCAGAAGCCGCCCCTCTGGCTTTCGGCCTTTCAAGAAAGGGCCACATT
TACGCCAATACAAAGCTGCTGGCCAAGAACTGCACCTCGTTCGTGGTCACCCCGAGCCATCTCATTTTTACGACC
AGTAATCACTTTATCAAGTATGTGCACTTGGCTCCTGATGTTCACGATCTGGAAGTTCCGGAAGACGACCCGGAG
AAGGACGAAAGATGCCGTAGTGTCGAACGCGGCTCTCGTTTGGTTGCTGCTATTCCCACAAACATGAGCATTGTT
TTGCAGATGCCAAGAGGGAATGTCGAAACCATCTTCCCACGTGCCATGGTCGTTGCCGGGGTCCGTGACCTCATC
GGCCAGGGAAACTATGGTCGAGCCTTCTCATATTGCCGTACCCAGCGTGTCGACATGAATATTCTGTGTGACCAT
AAGCCCGAGCAGTTCCTGGCTAGCATTGGATCGTTCTTGAACCAGCTTAAAGAGGTAGCGCATATTGACCTCTTC
CTGTCATCTTTGAGAGAGGAGGACGTAACTCAGACCATGTATTCGGACACCAAGTGTCGACCTACGCAACAAAAC
CCAAACCACGCAGAAAACGGCAGTTCTGCGTTCGTGTGGCCCACCGGCACCAAAGTCAAAACCGTGTGCGACGCC
CTGCTAAACAGTCTTCAATCTCGCAAGGGCGCCGACCTTCAGAACATCATCACTGCGCACGTGTGTAAGATCCCG
CCTGCTCTGGACGACAGTCTGACCCTCGTCGCCGAGTTGATGCAGGAGGACGAGAACGTAGCGGAGAAGGCGATT
GAGCACATCTGCTTTCTGGTGGATGTCAACCGGGTCTATGACAACGCGCTCGGACTGTACAACCTTGACCTCGCC
TTGTTGGTTGCGCAGCAATCACAGCGAGATCCTCGAGAATACCTGCCTTACATTCAGAACCTCCACACCCTGCCT
GAGGTGCGCCGCAAGTTCGAGATCGATGACCACCTTGGTTGCCGGTCGAAGGCCCTGAAACACCTCCACGTGCTG
GGCGAGTTCGACGAACTCTGCCGCTACACCACCAAGCATGTGCTATACCAGGACGCCCTCAGACTCTATCGCTAC
GAAGAGCCTCGACTGCGAATCTTAACCGATCTATACGCCGCTCACCTGGAATCTAAGTCGGCTTTCCGCGAGGCC
GGTGTTGCTCATGAGTCTCTCCAGAATTATGCAAAGGCGACAAGTTGCTACCGCGCAGCCGGTGCCACGTGCTGG
CAAGAATGCCTCTATACGGCCCAACAGCAGTCTCCCGGTCTCTCCGACGACGCCATGTCCGATCTGGCCACGAGC
TTGGCTGATGCTCTCTGGGAAGCCAAGGACTACAGCGCTGCTGCGACCATCCACCTTGAGTATCTGTCGTCCCTC
GAGACGGCTGTCAAATGCCTCTGCAAGGGCTACAATTTCGCCGAGGCCATCCGCCTCGTTGTCCAGCGAGGCCGC
CCTGACCTCCTCGAGGCGGCCGTCGACGTGGGTCTCGCGGAAGCCCTAGGCAGCACGACCGAGTTTCTCGCCGAC
TGCAAAGGCCAGCTCGACGCGCAGGTGCCCCGCATCGCCGAGCTGCGTCGCAGGGCAGCTGAGGACCCGCTGGCT
TTCTACGAGGGCGAGCCTCGCGTTTGA
Gene >Hirsu2|3591
ATGGATATTCTGGCAGACAATCTGAACTTTGCATCTATCTCCACTTTCGAGGATGACACATCAACAGAAGGCTAC
GGTCAGGACCTCTCAGGAAATCTCTACAAGCTGTCAAAGTCGTATTCGGAGCCGCTGCCCATTCGATTTCCATCG
CATCTCCCCTGGTTTGACGTTAGCAAGCCAGAAGCCGCCCCTCTGGCTTTCGGCCTTTCAAGAAAGGGCCACATT
TACGCCAATACAAAGCTGCTGGCCAAGAACTGCACCTCGTTCGTGGTCACCCCGAGCCATCTCATTTTTACGACC
AGTAATCACTTTATCAAGTATGTGCACTTGGCTCCTGATGTTCACGGTGAGAATTTCCCGGATGCCGCCCGTGAC
ACACAAACCGGCCGACTCACATCACTTGCTAGATCTGGAAGTTCCGGAAGACGACCCGGAGAAGGACGAAAGATG
CCGTAGTGTCGAACGCGGCTCTCGTTTGGTTGCTGCTATTCCCACAAACATGAGCATTGTTTTGCAGATGCCAAG
AGGGAATGTCGAAACCATCTTCCCACGTGCCATGGTCGTTGCCGGGGTCCGTGACCTCATCGGCCAGGGAAACTA
TGGTCGAGCCTTCTCATATTGCCGTACCCAGCGTGTCGACATGAATATTCTGTGTGACCATAAGCCCGAGCAGTT
CCTGGCTAGCATTGGATCGTTCTTGAACCAGCTTAAAGAGGTAGCGCATATTGACCTCTTCCTGTCATCTTTGAG
GTAGTGCCCAACTCGAATTATCTATCGGCGCCATTCATTGCAGCTAACATCAATCACAGAGAGGAGGACGTAACT
CAGACCATGTATTCGGACACCAAGTGTCGACCTACGCAACAAAACCCAAACCACGCAGAAAACGGCAGTTCTGCG
TTCGTGTGGCCCACCGGCACCAAAGTCAAAACCGTGTGCGACGCCCTGCTAAACAGTCTTCAATCTCGCAAGGGC
GCCGACCTTCAGAACATCATCACTGCGCACGTGTGTAAGATCCCGCCTGCTCTGGACGACAGTCTGACCCTCGTC
GCCGAGTTGATGCAGGAGGACGAGAACGTAGCGGAGAAGGCGATTGAGCACATCTGCTTTCTGGTGGATGTCAAC
CGGGTCTATGACAACGCGCTCGGACTGTACAACCTTGACCTCGCCTTGTTGGTTGCGCAGCAATCACAGCGAGAT
CCTCGAGAATACCTGCCTTACATTCAGAACCTCCACACCCTGCCTGAGGTGCGCCGCAAGTTCGAGATCGATGAC
CACCTTGGTTGCCGGTCGAAGGCCCTGAAACACCTCCACGTGCTGGGCGAGTTCGACGAACTCTGCCGCTACACC
ACCAAGCATGTGCTATACCAGGACGCCCTCAGACTCTATCGCTACGAAGAGCCTCGACTGCGAATCTTAACCGAT
CTATACGCCGCTCACCTGGAATCTAAGTCGGCTTTCCGCGAGGCCGGTGTTGCTCATGAGTCTCTCCAGAATTAT
GCAAAGGCGACAAGTTGCTACCGCGCAGCCGGTGCCACGTGCTGGCAAGAATGCCTCTATACGGCCCAACAGCAG
TCTCCCGGTCTCTCCGACGACGCCATGTCCGATCTGGCCACGAGCTTGGCTGATGCTCTCTGGGAAGCCAAGGAC
TACAGCGCTGCTGCGACCATCCACCTTGAGTATCTGTCGTCCCTCGAGACGGCTGTCAAATGCCTCTGCAAGGGC
TACAATTTCGCCGAGGCCATCCGCCTCGTTGTCCAGCGAGGCCGCCCTGACCTCCTCGAGGCGGCCGTCGACGTG
GGTCTCGCGGAAGCCCTAGGCAGCACGACCGAGTTTCTCGCCGACTGCAAAGGCCAGCTCGACGCGCAGGTGCCC
CGCATCGCCGAGCTGCGTCGCAGGGCAGCTGAGGACCCGCTGGCTTTCTACGAGGGCGAGCGTGTCGGAGGGGAG
GACATCCCCGACGACGTCTCGGTCGCGGCCAGCTCGCGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail