Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3589
Gene name
LocationContig_1954:2566..3846
Strand+
Gene length (bp)1280
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00786 PBD P21-Rho-binding domain 9.3E-23 193 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 81 251 6.0E-37
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 76 251 1.0E-35
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 8 251 3.0E-35
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 81 272 3.0E-24
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 82 252 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 81 251 6.0E-37
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 76 251 1.0E-35
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 8 251 3.0E-35
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 81 272 3.0E-24
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 82 252 5.0E-22
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 82 252 2.0E-21
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 193 301 1.0E-17
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 193 286 4.0E-17
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 193 286 4.0E-17
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 193 286 4.0E-17
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 193 286 5.0E-17
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 193 295 3.0E-16
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 193 274 5.0E-15
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 193 274 5.0E-15
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 193 274 5.0E-15
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 193 274 5.0E-15
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 193 252 4.0E-13
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 193 251 7.0E-13
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 193 295 8.0E-13
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 193 256 1.0E-12
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 193 254 1.0E-12
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 193 295 1.0E-12
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 193 253 1.0E-12
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 193 295 1.0E-12
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 193 295 1.0E-12
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 193 295 1.0E-12
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 186 251 1.0E-12
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 150 249 1.0E-11
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 179 254 1.0E-11
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 193 254 2.0E-11
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 193 261 2.0E-11
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 193 254 3.0E-11
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 193 260 2.0E-10
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 193 257 2.0E-10
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 193 260 2.0E-10
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 193 260 2.0E-10
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 193 255 4.0E-10
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 193 251 2.0E-09
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 193 249 1.0E-07
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 164 265 5.0E-07
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 193 227 2.0E-06
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 193 227 2.0E-06
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 193 227 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3589
MAQNTMYSSGQFMNPGPAPRPPTDRPRLNLTPNTNLPGSMANMAISPIRSTATSTYTGSTISLPIARQQSNSTDG
MGGVAVKKEGWASVKESKNFIQPWKSKYLILRKESLDFHKTEGGKVAYTLYLRDVVNVGRVEQAGTIFEIKRKAD
GPSSSPGDDDGQTKTLQIKVKSDDDLYEWIDFIYGACPGMGGVSNPTNFSHAVHVGFDPQTGEFIGLPPEWSKLL
NSSAITKEDYERNPQAVFEVLDFYTDLAKRAENPNQYSSLTPTPPPSQGKQQLSYGSGNSIAPPRPAPPAPEATG
SE*
Coding >Hirsu2|3589
ATGGCTCAGAACACAATGTATTCCTCGGGGCAGTTTATGAATCCCGGCCCTGCGCCCCGGCCACCTACTGACAGG
CCTCGCCTGAACCTGACGCCAAACACCAATCTTCCGGGGAGCATGGCGAACATGGCGATTTCCCCCATCCGGAGC
ACGGCTACCTCGACCTACACCGGCTCCACCATTTCCCTGCCCATCGCCCGCCAACAGTCGAACAGCACCGACGGC
ATGGGGGGCGTTGCGGTCAAGAAGGAAGGCTGGGCTTCGGTCAAGGAGAGCAAGAACTTCATCCAGCCCTGGAAG
TCCAAGTACCTGATACTCCGCAAGGAGTCTTTGGACTTCCACAAGACGGAAGGTGGTAAAGTTGCCTACACACTC
TATCTCCGGGATGTCGTCAACGTCGGCAGGGTGGAACAGGCCGGCACCATCTTTGAGATCAAGAGAAAGGCCGAC
GGTCCCTCTAGCAGTCCCGGCGACGACGACGGACAGACGAAGACGCTCCAGATCAAGGTCAAGAGCGACGACGAC
CTCTACGAATGGATCGACTTCATTTACGGCGCGTGTCCAGGCATGGGCGGCGTGAGCAACCCGACCAACTTCTCG
CACGCCGTCCATGTCGGCTTCGATCCGCAGACGGGAGAGTTCATAGGCCTTCCCCCGGAATGGTCCAAACTCCTC
AACTCGTCTGCCATCACCAAGGAGGACTATGAGAGAAATCCGCAGGCTGTCTTCGAGGTCCTCGACTTCTATACC
GACCTCGCCAAGAGGGCCGAAAACCCGAATCAGTACTCGAGCCTGACCCCGACGCCTCCACCGTCCCAGGGCAAG
CAACAACTCTCGTACGGCAGCGGAAACTCGATAGCGCCCCCCCGCCCAGCGCCTCCCGCGCCCGAGGCGACCGGC
TCAGAATGA
Transcript >Hirsu2|3589
ATGGCTCAGAACACAATGTATTCCTCGGGGCAGTTTATGAATCCCGGCCCTGCGCCCCGGCCACCTACTGACAGG
CCTCGCCTGAACCTGACGCCAAACACCAATCTTCCGGGGAGCATGGCGAACATGGCGATTTCCCCCATCCGGAGC
ACGGCTACCTCGACCTACACCGGCTCCACCATTTCCCTGCCCATCGCCCGCCAACAGTCGAACAGCACCGACGGC
ATGGGGGGCGTTGCGGTCAAGAAGGAAGGCTGGGCTTCGGTCAAGGAGAGCAAGAACTTCATCCAGCCCTGGAAG
TCCAAGTACCTGATACTCCGCAAGGAGTCTTTGGACTTCCACAAGACGGAAGGTGGTAAAGTTGCCTACACACTC
TATCTCCGGGATGTCGTCAACGTCGGCAGGGTGGAACAGGCCGGCACCATCTTTGAGATCAAGAGAAAGGCCGAC
GGTCCCTCTAGCAGTCCCGGCGACGACGACGGACAGACGAAGACGCTCCAGATCAAGGTCAAGAGCGACGACGAC
CTCTACGAATGGATCGACTTCATTTACGGCGCGTGTCCAGGCATGGGCGGCGTGAGCAACCCGACCAACTTCTCG
CACGCCGTCCATGTCGGCTTCGATCCGCAGACGGGAGAGTTCATAGGCCTTCCCCCGGAATGGTCCAAACTCCTC
AACTCGTCTGCCATCACCAAGGAGGACTATGAGAGAAATCCGCAGGCTGTCTTCGAGGTCCTCGACTTCTATACC
GACCTCGCCAAGAGGGCCGAAAACCCGAATCAGTACTCGAGCCTGACCCCGACGCCTCCACCGTCCCAGGGCAAG
CAACAACTCTCGTACGGCAGCGGAAACTCGATAGCGCCCCCCCGCCCAGCGCCTCCCGCGCCCGAGGCGACCGGC
TCAGAATGA
Gene >Hirsu2|3589
ATGGCTCAGAACACGTAAGTCGCCTGTTCCATCCTGACCTCGGCGCACGGGAGCTTGCCTCGGCCGGAGCGTGAC
AAATGTCCGACTCTTGCAACCTTTTACGAATCCCGCGAGTCGTGGCAGCCCAGCCTGTCCGACTGCGACCCCCAA
CTCCTCCTTCCTCCCACTCCCCTGCAACGAGAGTATCGGTGGGGTTGCGTACGGTGGCTCGGGCGGAGGTTGCCT
CTCTCGTCGGAATCGCCTCCCAATCCAGAGCTCTCCCCCATCAAAAACCAAACGTTTCCGTGCGATTGTGCCAAT
GCGGGCGGACGAAAGCTAACGGGCTCCAGAATGTATTCCTCGGGGCAGTTTATGAATCCCGGCCCTGCGCCCCGG
CCACCTACTGACAGGCCTCGCCTGAACCTGACGCCAAACACCAATCTTCCGGGGAGCATGGCGAACATGGCGATT
TCCCCCATCCGGAGCACGGCTACCTCGACCTACACCGGCTCCACCATTTCCCTGCCCATCGCCCGCCAACAGTCG
AACAGCACCGACGGCATGGGGGGCGTTGCGGTCAAGAAGGAAGGCTGGGCTTCGGTCAAGGAGAGCAAGAACTTC
ATCCAGCCCTGGAAGTCCAAGTACCTGATACTCCGCAAGGAGTCTTTGGACTTCCACAAGACGGAAGGTGGTAAA
GTTGCCTACACACTCTATCTCCGGGATGTCGTCAACGTCGGCAGGGTGGAACAGGCCGGCACCATCTTTGAGATC
AAGAGAAAGGCCGACGGTCCCTCTAGCAGTCCCGGCGACGACGACGGACAGACGAAGACGCTCCAGATCAAGGTC
AAGAGCGACGACGACCTCTACGAATGGATCGACTTCATTTACGGCGCGTGTCCAGGCATGGGCGGCGTGAGCAAC
CCGACCAACTTCTCGCACGCCGTCCATGTCGGCTTCGATCCGCAGACGGGAGAGTTCATAGGCCTTCCCCCGGAA
TGGTCCAAACTCCTCAACTCGTCTGCCATCACCAAGGAGGACTATGAGAGAAATCCGCAGGCTGTCTTCGAGGTC
CTCGACTTCTATACCGACCTCGCCAAGAGGGCCGAAAACCCGAATCAGTACTCGAGCCTGACCCCGACGCCTCCA
CCGTCCCAGGGCAAGCAACAACTCTCGTACGGCAGCGGAAACTCGATAGCGCCCCCCCGCCCAGCGCCTCCCGCG
CCCGGTCCGCGCAACCCGAGCTACAGCACAACGCCCCCCCAGTCGAGTGGTGCCTCGCAGAGGCGACCGGCTCAG
AATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail