Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|358
Gene name
LocationContig_107:2331..3911
Strand-
Gene length (bp)1580
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01424 R3H R3H domain 1.8E-14 184 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74853|FAP1H_SCHPO FKBP12-associated protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 8 403 8.0E-43
sp|Q12986|NFX1_HUMAN Transcriptional repressor NF-X1 OS=Homo sapiens GN=NFX1 PE=1 SV=2 3 266 4.0E-32
sp|A6QLA0|NFX1_BOVIN Transcriptional repressor NF-X1 OS=Bos taurus GN=NFX1 PE=2 SV=1 3 278 8.0E-32
sp|B1AY10|NFX1_MOUSE Transcriptional repressor NF-X1 OS=Mus musculus GN=Nfx1 PE=1 SV=1 3 266 4.0E-31
sp|P53971|FAP1_YEAST FKBP12-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAP1 PE=1 SV=1 5 387 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74853|FAP1H_SCHPO FKBP12-associated protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fap1 PE=1 SV=1 8 403 8.0E-43
sp|Q12986|NFX1_HUMAN Transcriptional repressor NF-X1 OS=Homo sapiens GN=NFX1 PE=1 SV=2 3 266 4.0E-32
sp|A6QLA0|NFX1_BOVIN Transcriptional repressor NF-X1 OS=Bos taurus GN=NFX1 PE=2 SV=1 3 278 8.0E-32
sp|B1AY10|NFX1_MOUSE Transcriptional repressor NF-X1 OS=Mus musculus GN=Nfx1 PE=1 SV=1 3 266 4.0E-31
sp|P53971|FAP1_YEAST FKBP12-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAP1 PE=1 SV=1 5 387 3.0E-29
sp|Q18034|NFX1_CAEEL Transcriptional repressor NF-X1 homolog OS=Caenorhabditis elegans GN=nfx-1 PE=3 SV=1 3 241 1.0E-20
sp|P40798|STC_DROME Protein shuttle craft OS=Drosophila melanogaster GN=stc PE=1 SV=2 3 241 1.0E-17
sp|Q9SY59|NFXL1_ARATH NF-X1-type zinc finger protein NFXL1 OS=Arabidopsis thaliana GN=NFXL1 PE=2 SV=1 8 314 1.0E-17
sp|Q9FFK8|NFXL2_ARATH NF-X1-type zinc finger protein NFXL2 OS=Arabidopsis thaliana GN=NFXL2 PE=1 SV=2 11 134 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|358
MRHADVACPKCPFLVGKWCACGKEKLQSQPCHLQEAHCGRPCGKRLKCGLHSCRKLCHRPGECEDVQVPDKRCDQ
VCGKTKLFCEHPCQKPCHGQTTCNESAACTAKAMVSCPCGLRLLEVKCLASSSNPAPPRPDVKCDDECLRMDRNR
RLAAALNIDPSSHTNDHVPYSDISLKLFKENVAWAETQEREFRVFSKSPNEVRMRYKPMSSTYRQFLHALAEDYG
LESRSEDVEPHRYVVVFKGSRFVSAPTKTLAQCVKIREMQAAEAAATSRPPSPPPGPGPEPFNSFLLTSPRFGLT
VEEVKAALEGELASQPSIHFAISFLPTEEILLRATAHYSAFLSPAAMEQALTGLKPGLAKAVKGTGVAGSILLCR
ADAGEHISRREDLSSKGSSGWSAVAGRAAARGPSAPPTEEAPARGGGRKLLGLRRKKAAEQGGGKTWDALGGDVE
C*
Coding >Hirsu2|358
ATGCGGCACGCCGACGTTGCTTGCCCGAAGTGCCCCTTTCTCGTCGGAAAGTGGTGCGCCTGCGGCAAAGAAAAG
CTCCAGAGCCAGCCATGCCACCTGCAAGAGGCGCACTGTGGCAGGCCCTGCGGCAAGAGGCTCAAGTGCGGGCTG
CACAGTTGCCGGAAGCTATGCCATCGACCCGGCGAATGCGAGGATGTCCAGGTTCCGGACAAACGTTGCGACCAG
GTCTGTGGCAAGACAAAGCTCTTCTGCGAGCATCCGTGCCAGAAACCGTGCCACGGGCAGACCACCTGCAACGAG
TCTGCTGCTTGCACCGCCAAAGCCATGGTCAGCTGTCCCTGCGGCCTTCGTCTGCTGGAGGTGAAATGCCTGGCA
AGCAGCTCGAACCCGGCACCCCCCAGGCCGGACGTCAAGTGCGATGACGAGTGTCTCCGGATGGATCGTAACCGC
CGCCTCGCAGCCGCGCTCAACATTGACCCGTCGTCGCACACCAACGACCACGTTCCCTACTCGGACATTTCCCTC
AAGCTGTTCAAGGAGAACGTGGCGTGGGCCGAGACGCAGGAGCGTGAGTTCCGCGTCTTCTCGAAGAGCCCGAAC
GAGGTCAGGATGCGCTACAAACCCATGTCGTCTACGTACCGGCAGTTCCTGCACGCCCTGGCGGAAGATTACGGC
CTCGAGAGCAGAAGCGAGGACGTCGAGCCGCATCGCTATGTCGTCGTCTTCAAGGGCTCCCGATTCGTGTCTGCG
CCGACCAAGACGCTGGCGCAGTGCGTCAAGATCCGCGAGATGCAGGCGGCGGAGGCGGCGGCGACGTCGCGGCCC
CCCAGCCCGCCTCCCGGGCCGGGCCCCGAACCATTCAACAGTTTCCTCCTGACGTCGCCCCGGTTCGGCCTTACC
GTGGAAGAAGTCAAGGCGGCGCTGGAGGGAGAACTGGCTTCGCAGCCGTCGATACACTTCGCCATCAGCTTTCTC
CCGACCGAAGAGATTCTCCTCCGGGCCACGGCCCACTACTCGGCGTTCCTGTCGCCGGCCGCCATGGAACAAGCG
CTCACGGGCCTGAAGCCGGGCCTCGCCAAGGCGGTCAAGGGCACCGGCGTGGCGGGCAGCATCCTGCTCTGCCGT
GCGGACGCGGGCGAGCACATCTCGCGACGGGAGGACCTGAGCAGCAAGGGCAGTTCGGGGTGGAGCGCCGTGGCG
GGAAGGGCGGCGGCTCGGGGCCCGTCGGCCCCACCAACGGAGGAGGCGCCGGCGCGGGGCGGCGGGCGCAAGCTC
CTGGGCCTGCGGAGGAAGAAGGCGGCGGAGCAGGGGGGCGGCAAGACGTGGGACGCCCTGGGGGGAGACGTCGAG
TGCTGA
Transcript >Hirsu2|358
ATGCGGCACGCCGACGTTGCTTGCCCGAAGTGCCCCTTTCTCGTCGGAAAGTGGTGCGCCTGCGGCAAAGAAAAG
CTCCAGAGCCAGCCATGCCACCTGCAAGAGGCGCACTGTGGCAGGCCCTGCGGCAAGAGGCTCAAGTGCGGGCTG
CACAGTTGCCGGAAGCTATGCCATCGACCCGGCGAATGCGAGGATGTCCAGGTTCCGGACAAACGTTGCGACCAG
GTCTGTGGCAAGACAAAGCTCTTCTGCGAGCATCCGTGCCAGAAACCGTGCCACGGGCAGACCACCTGCAACGAG
TCTGCTGCTTGCACCGCCAAAGCCATGGTCAGCTGTCCCTGCGGCCTTCGTCTGCTGGAGGTGAAATGCCTGGCA
AGCAGCTCGAACCCGGCACCCCCCAGGCCGGACGTCAAGTGCGATGACGAGTGTCTCCGGATGGATCGTAACCGC
CGCCTCGCAGCCGCGCTCAACATTGACCCGTCGTCGCACACCAACGACCACGTTCCCTACTCGGACATTTCCCTC
AAGCTGTTCAAGGAGAACGTGGCGTGGGCCGAGACGCAGGAGCGTGAGTTCCGCGTCTTCTCGAAGAGCCCGAAC
GAGGTCAGGATGCGCTACAAACCCATGTCGTCTACGTACCGGCAGTTCCTGCACGCCCTGGCGGAAGATTACGGC
CTCGAGAGCAGAAGCGAGGACGTCGAGCCGCATCGCTATGTCGTCGTCTTCAAGGGCTCCCGATTCGTGTCTGCG
CCGACCAAGACGCTGGCGCAGTGCGTCAAGATCCGCGAGATGCAGGCGGCGGAGGCGGCGGCGACGTCGCGGCCC
CCCAGCCCGCCTCCCGGGCCGGGCCCCGAACCATTCAACAGTTTCCTCCTGACGTCGCCCCGGTTCGGCCTTACC
GTGGAAGAAGTCAAGGCGGCGCTGGAGGGAGAACTGGCTTCGCAGCCGTCGATACACTTCGCCATCAGCTTTCTC
CCGACCGAAGAGATTCTCCTCCGGGCCACGGCCCACTACTCGGCGTTCCTGTCGCCGGCCGCCATGGAACAAGCG
CTCACGGGCCTGAAGCCGGGCCTCGCCAAGGCGGTCAAGGGCACCGGCGTGGCGGGCAGCATCCTGCTCTGCCGT
GCGGACGCGGGCGAGCACATCTCGCGACGGGAGGACCTGAGCAGCAAGGGCAGTTCGGGGTGGAGCGCCGTGGCG
GGAAGGGCGGCGGCTCGGGGCCCGTCGGCCCCACCAACGGAGGAGGCGCCGGCGCGGGGCGGCGGGCGCAAGCTC
CTGGGCCTGCGGAGGAAGAAGGCGGCGGAGCAGGGGGGCGGCAAGACGTGGGACGCCCTGGGGGGAGACGTCGAG
TGCTGA
Gene >Hirsu2|358
ATGCGGCACGCGTGCGCCGGAGTGTCGCTTCAACTGCCAAAGACGACCCGACTGCGGCCATCCTCCCATCGACCA
CGGCTGCCACCCCAGCGACGTTGCTTGCCCGAAGTGCCCCTTTCTCGTCGGAAAGTGGTGCGCCTGCGGCAAAGA
AAAGCTCCAGAGCCAGCCATGCCACCTGCAAGAGGCGCACTGTGGCAGGCCCTGCGGCAAGAGGCTCAAGTGCGG
GTATGTTGTGATCGTCCCTCGCCGGGACCGGCTTGACCCGGTGACGGCCAGCCATGCTAACAAAGTCCTTCCGTC
CCGGCTCCAGGCTGCACAGTTGCCGGAAGCTATGCCATCGACCCGGCGAATGCGAGGATGTCCAGGTTCCGGACA
AACGTTGCGACCAGGTCTGTGGCAAGACAAAGCTCTTCTGCGAGCATCCGTGCCAGAAACCGTGCCACGGGCAGA
CCAGTAAGCCTGACACCGTGAGACGCGATGGCTGCAAGACATGGACGAACTGACAGACCGAAGCCTGCAACGAGT
CTGCTGCTTGCACCGCCAAAGCCATGGTCAGCTGTCCCTGCGGCCTTCGTCTGCTGGAGGTGAAATGCCTGGCAA
GCAGCTCGAACCCGGCACCCCCCAGGCCGGACGTCAAGTGCGATGACGAGTGTCTCCGGATGGATCGTAACCGCC
GCCTCGCAGCCGCGCTCAACATTGACCCGTCGTCGCACACCAACGACCACGTTCCCTACTCGGACATTTCCCTCA
AGCTGTTCAAGGAGAACGTGGCGTGGGCCGAGACGCAGGAGCGTGAGTTCCGCGTCTTCTCGAAGAGCCCGAACG
AGGTCAGGATGCGCTACAAACCCATGTCGTCTACGTACCGGCAGTTCCTGCACGCCCTGGCGGAAGATTACGGCC
TCGAGAGCAGAAGCGAGGACGTCGAGCCGCATCGCTATGTCGTCGTCTTCAAGGGCTCCCGATTCGTGTCTGCGC
CGACCAAGACGCTGGCGCAGTGCGTCAAGATCCGCGAGATGCAGGCGGCGGAGGCGGCGGCGACGTCGCGGCCCC
CCAGCCCGCCTCCCGGGCCGGGCCCCGAACCATTCAACAGTTTCCTCCTGACGTCGCCCCGGTTCGGCCTTACCG
TGGAAGAAGTCAAGGCGGCGCTGGAGGGAGAACTGGCTTCGCAGCCGTCGATACACTTCGCCATCAGCTTTCTCC
CGACCGAAGAGATTCTCCTCCGGGCCACGGCCCACTACTCGGCGTTCCTGTCGCCGGCCGCCATGGAACAAGCGC
TCACGGGCCTGAAGCCGGGCCTCGCCAAGGCGGTCAAGGGCACCGGCGTGGCGGGCAGCATCCTGCTCTGCCGTG
CGGACGCGGGCGAGCACATCTCGCGACGGGAGGACCTGAGCAGCAAGGGCAGTTCGGGGTGGAGCGCCGTGGCGG
GAAGGGCGGCGGCTCGGGGCCCGTCGGCCCCACCAACGGAGGAGGCGCCGGCGCGGGGCGGCGGGCGCAAGCTCC
TGGGCCTGCGGAGGAAGAAGGCGGCGGAGCAGGGGGGCGGCAAGACGTGGGACGCCCTGGGGGGAGACGTCGAGT
GCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail