© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|3572 |
| Gene name | |
| Location | Contig_1948:90..973 |
| Strand | - |
| Gene length (bp) | 883 |
| Transcript length (bp) | 816 |
| Coding sequence length (bp) | 816 |
| Protein length (aa) | 272 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00501 | AMP-binding | AMP-binding enzyme | 7.5E-35 | 58 | 270 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 30 | 270 | 6.0E-49 |
| sp|Q4WF53|NRPS4_ASPFU | Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 | 34 | 271 | 1.0E-43 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 41 | 271 | 1.0E-42 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 30 | 271 | 1.0E-39 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 32 | 271 | 4.0E-38 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 30 | 270 | 6.0E-49 |
| sp|Q4WF53|NRPS4_ASPFU | Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 | 34 | 271 | 1.0E-43 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 41 | 271 | 1.0E-42 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 30 | 271 | 1.0E-39 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 32 | 271 | 4.0E-38 |
| sp|Q4WYP0|NRPS6_ASPFU | Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 | 21 | 271 | 1.0E-36 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 33 | 271 | 3.0E-35 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 49 | 270 | 4.0E-35 |
| sp|Q4WMK2|NRPS9_ASPFU | Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 | 35 | 270 | 8.0E-34 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 39 | 271 | 3.0E-33 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 49 | 270 | 2.0E-32 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 49 | 270 | 2.0E-32 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 12 | 271 | 7.0E-32 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 47 | 271 | 2.0E-31 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 41 | 271 | 2.0E-29 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 41 | 271 | 2.0E-28 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 38 | 271 | 4.0E-28 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 37 | 271 | 5.0E-28 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 44 | 271 | 9.0E-28 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 46 | 271 | 1.0E-27 |
| sp|Q4WLW8|NRP11_ASPFU | Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 | 48 | 271 | 5.0E-27 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 41 | 271 | 6.0E-27 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 31 | 271 | 8.0E-27 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 29 | 271 | 1.0E-25 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 32 | 271 | 5.0E-25 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 52 | 271 | 5.0E-25 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 31 | 271 | 4.0E-24 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 31 | 271 | 5.0E-24 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 43 | 270 | 9.0E-24 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 42 | 223 | 5.0E-22 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 47 | 270 | 5.0E-21 |
| sp|P09095|TYCA_BREPA | Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 | 40 | 270 | 5.0E-20 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 27 | 270 | 8.0E-20 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 41 | 271 | 2.0E-19 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 23 | 270 | 2.0E-19 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 50 | 270 | 7.0E-19 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 47 | 270 | 1.0E-18 |
| sp|Q08787|SRFAC_BACSU | Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 | 57 | 250 | 1.0E-18 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 43 | 270 | 2.0E-18 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 41 | 271 | 3.0E-18 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 41 | 271 | 4.0E-18 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 33 | 270 | 4.0E-18 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 44 | 270 | 4.0E-18 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 49 | 270 | 2.0E-17 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 76 | 270 | 2.0E-17 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 32 | 246 | 2.0E-17 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 28 | 268 | 3.0E-17 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 52 | 271 | 3.0E-17 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 28 | 268 | 6.0E-17 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 47 | 222 | 1.0E-16 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 47 | 270 | 1.0E-16 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 47 | 248 | 1.0E-16 |
| sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 76 | 256 | 1.0E-16 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 26 | 270 | 1.0E-16 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 47 | 260 | 2.0E-16 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 48 | 271 | 2.0E-16 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 40 | 270 | 2.0E-16 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 47 | 270 | 3.0E-16 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 23 | 270 | 4.0E-16 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 47 | 270 | 5.0E-16 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 47 | 260 | 6.0E-16 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 47 | 232 | 6.0E-16 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 51 | 270 | 6.0E-16 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 47 | 270 | 1.0E-15 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 36 | 246 | 1.0E-15 |
| sp|P0C062|GRSA_BREBE | Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 | 41 | 270 | 2.0E-15 |
| sp|P0C061|GRSA_ANEMI | Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 | 41 | 270 | 2.0E-15 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 34 | 246 | 2.0E-15 |
| sp|Q9L9G0|NOVH_STRNV | Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 | 50 | 271 | 2.0E-15 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 34 | 246 | 2.0E-15 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 36 | 246 | 4.0E-15 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 64 | 271 | 4.0E-15 |
| sp|O31782|PKSN_BACSU | Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 | 49 | 223 | 4.0E-15 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 41 | 270 | 5.0E-15 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 62 | 270 | 5.0E-15 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 47 | 270 | 5.0E-15 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 40 | 250 | 8.0E-15 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 47 | 270 | 1.0E-14 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 56 | 270 | 2.0E-14 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 45 | 228 | 2.0E-14 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 47 | 245 | 2.0E-14 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 43 | 268 | 2.0E-14 |
| sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 53 | 266 | 2.0E-14 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 53 | 270 | 2.0E-14 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 43 | 268 | 2.0E-14 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 41 | 228 | 3.0E-14 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 41 | 228 | 3.0E-14 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 47 | 250 | 3.0E-14 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 47 | 249 | 4.0E-14 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 34 | 270 | 5.0E-14 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 49 | 270 | 7.0E-14 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 26 | 250 | 7.0E-14 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 47 | 270 | 2.0E-13 |
| sp|Q88VM6|DLTA_LACPL | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 | 77 | 268 | 2.0E-13 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 64 | 226 | 3.0E-13 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 52 | 250 | 3.0E-13 |
| sp|O31827|PPSE_BACSU | Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 | 41 | 228 | 4.0E-13 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 64 | 221 | 5.0E-13 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 64 | 270 | 5.0E-13 |
| sp|Q8CT93|DLTA_STAES | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 | 55 | 270 | 6.0E-13 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 41 | 221 | 7.0E-13 |
| sp|Q5HQN0|DLTA_STAEQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 | 55 | 270 | 7.0E-13 |
| sp|P35854|DLTA_LACRH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 | 56 | 268 | 8.0E-13 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 37 | 251 | 1.0E-12 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 52 | 268 | 1.0E-12 |
| sp|Q8XBV9|ENTF_ECO57 | Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 | 41 | 232 | 1.0E-12 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 47 | 238 | 1.0E-12 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 40 | 230 | 2.0E-12 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 68 | 271 | 2.0E-12 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 68 | 271 | 2.0E-12 |
| sp|P11454|ENTF_ECOLI | Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 | 41 | 232 | 2.0E-12 |
| sp|P29698|ENTF_SHIFL | Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 | 41 | 232 | 2.0E-12 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 35 | 228 | 3.0E-12 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 17 | 231 | 5.0E-12 |
| sp|Q01757|ACVS_STRCL | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 | 47 | 270 | 5.0E-12 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 55 | 271 | 7.0E-12 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 13 | 248 | 8.0E-12 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 41 | 271 | 9.0E-12 |
| sp|Q9R9J1|MYCA_BACIU | Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 | 62 | 270 | 1.0E-11 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 37 | 248 | 1.0E-11 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 17 | 270 | 2.0E-11 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 51 | 270 | 3.0E-11 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 47 | 223 | 3.0E-11 |
| sp|Q65DH1|DLTA_BACLD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 | 56 | 268 | 3.0E-11 |
| sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 71 | 270 | 3.0E-11 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 47 | 223 | 4.0E-11 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 73 | 268 | 6.0E-11 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 52 | 271 | 1.0E-10 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 52 | 253 | 2.0E-10 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 67 | 235 | 2.0E-10 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 17 | 231 | 2.0E-10 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 52 | 223 | 2.0E-10 |
| sp|Q03AZ2|DLTA_LACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 | 56 | 268 | 2.0E-10 |
| sp|B3WC77|DLTA_LACCB | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 | 56 | 268 | 3.0E-10 |
| sp|P0C397|DLTA_STAAU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 | 63 | 270 | 3.0E-10 |
| sp|P99107|DLTA_STAAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 | 63 | 270 | 3.0E-10 |
| sp|P68876|DLTA_STAAM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 | 63 | 270 | 3.0E-10 |
| sp|A5IRB0|DLTA_STAA9 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 | 63 | 270 | 3.0E-10 |
| sp|A6U039|DLTA_STAA2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 | 63 | 270 | 3.0E-10 |
| sp|A7X0D6|DLTA_STAA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 | 63 | 270 | 3.0E-10 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 47 | 270 | 4.0E-10 |
| sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 46 | 228 | 4.0E-10 |
| sp|Q6GIF6|DLTA_STAAR | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 | 63 | 270 | 5.0E-10 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 41 | 270 | 7.0E-10 |
| sp|P68878|DLTA_STAAW | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|A8Z1J1|DLTA_STAAT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|Q6GAZ4|DLTA_STAAS | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|A6QFE3|DLTA_STAAE | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|Q5HHF2|DLTA_STAAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|Q2FZW6|DLTA_STAA8 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|Q2FIE3|DLTA_STAA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|Q2YWQ8|DLTA_STAAB | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-10 |
| sp|Q1B6A7|MBTB_MYCSS | Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 | 33 | 270 | 8.0E-10 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 32 | 270 | 2.0E-09 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 52 | 270 | 2.0E-09 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 46 | 270 | 2.0E-09 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 76 | 228 | 3.0E-09 |
| sp|P48633|HMWP2_YERE8 | High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 | 39 | 270 | 3.0E-09 |
| sp|P0DJH0|ANGR_VIBAN | Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 | 46 | 270 | 5.0E-09 |
| sp|Q6W4T3|ANGR_VIBA7 | Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 | 46 | 270 | 5.0E-09 |
| sp|B8DEG2|DLTA_LISMH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 | 76 | 269 | 6.0E-09 |
| sp|Q4L4U5|DLTA_STAHJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 | 63 | 270 | 7.0E-09 |
| sp|Q73XY1|MBTB_MYCPA | Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 | 39 | 270 | 1.0E-08 |
| sp|Q92D47|DLTA_LISIN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 | 76 | 269 | 1.0E-08 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 76 | 269 | 2.0E-08 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 44 | 270 | 2.0E-08 |
| sp|A0AH92|DLTA_LISW6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 | 76 | 268 | 2.0E-08 |
| sp|Q9CG49|DLTA_LACLA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 | 62 | 269 | 2.0E-08 |
| sp|C1L1P5|DLTA_LISMC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 | 76 | 269 | 2.0E-08 |
| sp|Q721J2|DLTA_LISMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 | 76 | 269 | 2.0E-08 |
| sp|A7GMR0|DLTA_BACCN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 | 56 | 268 | 2.0E-08 |
| sp|B7IN64|DLTA_BACC2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 | 55 | 268 | 4.0E-08 |
| sp|Q8Y8D4|DLTA_LISMO | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 | 76 | 269 | 8.0E-08 |
| sp|Q84P24|4CLL6_ARATH | 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 | 76 | 224 | 1.0E-07 |
| sp|Q6HLH7|DLTA_BACHK | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 | 56 | 268 | 1.0E-07 |
| sp|C1EM80|DLTA_BACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 | 56 | 268 | 1.0E-07 |
| sp|B7JFV5|DLTA_BACC0 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 | 56 | 268 | 1.0E-07 |
| sp|A0RBJ0|DLTA_BACAH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 | 56 | 268 | 1.0E-07 |
| sp|Q81T97|DLTA_BACAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 | 56 | 268 | 2.0E-07 |
| sp|C3LAH8|DLTA_BACAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 | 56 | 268 | 2.0E-07 |
| sp|C3P4I7|DLTA_BACAA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 | 56 | 268 | 2.0E-07 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 17 | 222 | 3.0E-07 |
| sp|Q53526|DLTA_STRMU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 | 54 | 269 | 3.0E-07 |
| sp|Q8GQN9|BCLA_THAAR | Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 | 43 | 265 | 3.0E-07 |
| sp|A7ZA74|DLTA_BACMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 | 56 | 270 | 3.0E-07 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 74 | 270 | 4.0E-07 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 76 | 269 | 5.0E-07 |
| sp|Q9AJS8|3HBCL_THAAR | 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 | 69 | 270 | 5.0E-07 |
| sp|P59591|DLTA_STRA5 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 | 51 | 269 | 6.0E-07 |
| sp|Q3JZ94|DLTA_STRA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 | 51 | 269 | 6.0E-07 |
| sp|Q8VM67|DLTA_STRA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 | 51 | 269 | 6.0E-07 |
| sp|Q9X2N4|DLTA_STAXY | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 | 76 | 225 | 7.0E-07 |
| sp|P9WQ63|MBTB_MYCTU | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 | 39 | 270 | 8.0E-07 |
| sp|Q7TYQ4|MBTB_MYCBO | Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 | 39 | 270 | 8.0E-07 |
| sp|P9WQ62|MBTB_MYCTO | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 | 39 | 270 | 9.0E-07 |
| sp|O07610|LCFB_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 | 56 | 243 | 2.0E-06 |
| sp|C1CB20|DLTA_STRP7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 | 63 | 269 | 2.0E-06 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 47 | 223 | 3.0E-06 |
| sp|C1CU95|DLTA_STRZT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 | 63 | 269 | 3.0E-06 |
| sp|B8ZQ14|DLTA_STRPJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 | 63 | 269 | 3.0E-06 |
| sp|C1CNE9|DLTA_STRZP | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 | 63 | 269 | 3.0E-06 |
| sp|P0A399|DLTA_STRR6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 | 63 | 269 | 3.0E-06 |
| sp|P0A398|DLTA_STRPN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 | 63 | 269 | 3.0E-06 |
| sp|Q04HZ7|DLTA_STRP2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 | 63 | 269 | 3.0E-06 |
| sp|P17814|4CL1_ORYSJ | Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 | 71 | 231 | 4.0E-06 |
| sp|Q9SMT7|4CLLA_ARATH | Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 | 75 | 228 | 6.0E-06 |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm|Nucleus | 0.6062 | 0.6024 | 0.1065 | 0.0666 | 0.2257 | 0.0448 | 0.0872 | 0.1247 | 0.2125 | 0.0942 |
| Orthofinder run ID | 4 |
| Orthogroup | 5 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|3572 MRYQVDQVANGGWRGGEEPTLKDHQAKETHPRALDDIWARNASVPEPVEACVHALVKRSVCEQPAAPAVCAWDGD LTYAELDQLSSRLARRLVDSWGLRPGVNALLCFDKSVLVPIAMLAIIKAGAAAVALDTTQPEDRLRLVATQVAAP VVLTSAANKPLASQLGAAEVVVVERQQLEEPEPASETPRHDELPLVSPSDVLYVAFTSGCSGTPKGAVITHRNFS SAVVYQQRALGFSSRSRVFDHASYASHLAWSNLLHTLTCGGCLCIP* |
| Coding | >Hirsu2|3572 ATGAGATACCAGGTCGACCAAGTGGCCAATGGAGGCTGGCGTGGCGGCGAAGAGCCCACGCTCAAGGACCACCAG GCCAAGGAGACGCACCCGCGTGCCCTCGATGACATCTGGGCCCGTAACGCGTCCGTGCCAGAGCCCGTAGAGGCC TGCGTCCACGCTCTCGTCAAGCGGAGCGTGTGTGAGCAGCCGGCCGCCCCGGCCGTGTGCGCCTGGGATGGCGAC CTGACCTATGCCGAGCTGGACCAGCTATCGAGCAGGCTGGCGCGCCGCCTGGTCGACTCTTGGGGCCTGCGGCCG GGCGTCAACGCCCTTCTCTGCTTCGACAAGTCGGTCCTCGTGCCCATCGCGATGCTGGCCATCATCAAGGCCGGC GCCGCTGCCGTCGCCCTTGACACGACCCAGCCCGAGGACCGGCTCCGACTAGTGGCCACCCAGGTCGCCGCACCC GTTGTCCTCACCTCGGCCGCCAACAAGCCCCTGGCGAGCCAGCTGGGGGCGGCCGAGGTGGTCGTTGTGGAGCGG CAGCAGCTCGAGGAGCCGGAGCCGGCTTCCGAGACCCCCCGGCACGACGAACTCCCGCTCGTGAGCCCATCCGAC GTGCTGTACGTCGCCTTCACCTCCGGCTGCAGCGGAACCCCCAAGGGGGCCGTCATCACGCATCGAAACTTCAGC AGCGCCGTCGTCTACCAGCAGAGGGCGCTCGGCTTCTCCAGCCGCTCCCGCGTCTTCGATCACGCCTCCTACGCC TCCCACCTCGCCTGGTCCAACCTGCTTCACACTCTGACCTGCGGCGGATGCCTGTGCATCCCCTGA |
| Transcript | >Hirsu2|3572 ATGAGATACCAGGTCGACCAAGTGGCCAATGGAGGCTGGCGTGGCGGCGAAGAGCCCACGCTCAAGGACCACCAG GCCAAGGAGACGCACCCGCGTGCCCTCGATGACATCTGGGCCCGTAACGCGTCCGTGCCAGAGCCCGTAGAGGCC TGCGTCCACGCTCTCGTCAAGCGGAGCGTGTGTGAGCAGCCGGCCGCCCCGGCCGTGTGCGCCTGGGATGGCGAC CTGACCTATGCCGAGCTGGACCAGCTATCGAGCAGGCTGGCGCGCCGCCTGGTCGACTCTTGGGGCCTGCGGCCG GGCGTCAACGCCCTTCTCTGCTTCGACAAGTCGGTCCTCGTGCCCATCGCGATGCTGGCCATCATCAAGGCCGGC GCCGCTGCCGTCGCCCTTGACACGACCCAGCCCGAGGACCGGCTCCGACTAGTGGCCACCCAGGTCGCCGCACCC GTTGTCCTCACCTCGGCCGCCAACAAGCCCCTGGCGAGCCAGCTGGGGGCGGCCGAGGTGGTCGTTGTGGAGCGG CAGCAGCTCGAGGAGCCGGAGCCGGCTTCCGAGACCCCCCGGCACGACGAACTCCCGCTCGTGAGCCCATCCGAC GTGCTGTACGTCGCCTTCACCTCCGGCTGCAGCGGAACCCCCAAGGGGGCCGTCATCACGCATCGAAACTTCAGC AGCGCCGTCGTCTACCAGCAGAGGGCGCTCGGCTTCTCCAGCCGCTCCCGCGTCTTCGATCACGCCTCCTACGCC TCCCACCTCGCCTGGTCCAACCTGCTTCACACTCTGACCTGCGGCGGATGCCTGTGCATCCCCTGA |
| Gene | >Hirsu2|3572 ATGAGATACCAGGTCGACCAAGTGGCCAATGGAGGCTGGCGTGGCGGCGAAGAGCCCACGCTCAAGGACCACCAG GCCAAGGAGACGCACCCGCGTGCCCTCGATGACATCTGGGCCCGTAACGCGTCCGTGCCAGAGCCCGTAGAGGCC TGCGTCCACGCTCTCGTCAAGCGGAGCGTGTGTGAGCAGCCGGCCGCCCCGGCCGTGTGCGCCTGGGATGGCGAC CTGACCTATGCCGAGCTGGACCAGCTATCGAGCAGGCTGGCGCGCCGCCTGGTCGACTCTTGGGGCCTGCGGCCG GGCGTCAACGCCCTTCTCTGCTTCGACAAGTCGGTCCTCGTGCCCATCGCGATGCTGGCCATCATCAAGGCCGGC GCCGCTGCCGTCGCCCTTGACACGACCCAGCCCGAGGACCGGCTCCGACTAGTGGCCACCCAGGTCGCCGCACCC GTTGTCCTCACCTCGGCCGCCAACAAGCCCCTGGCGAGCCAGCTGGGGGCGGCCGAGGTGGTCGTTGTGGAGCGG CAGCAGCTCGAGGAGCCGGAGCCGGCTTCCGAGACCCCCCGGCACGACGAACTCCCGCTCGTGAGCCCATCCGAC GTGCTGTACGTCGCCTTCACCTCCGGCTGCAGCGGAACCCCCAAGGGGGCCGTCATCACGCATCGAAACTTCAGC AGCGCCGTCGTCTACCAGCAGAGGGCGCTCGGCTTCTCCAGCCGCTCCCGCGTCTTCGATCACGCCTCCTACGCC TCCCACCTCGCCTGGTCCAACCTGCTTCACACTCTGACCTGCGGCGGATGCCTGTGCATCCCGTCCGAGGAGGAC CGGCGCGGCAACGTCGAGGGGTCCATGGCGGCCCTGCGAGCCAACTACGCGCAGCTGA |