Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3567
Gene name
LocationContig_1944:235..1487
Strand-
Gene length (bp)1252
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01794 Ferric_reduct Ferric reductase like transmembrane component 3.0E-16 147 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 145 361 3.0E-13
sp|C5M5S1|AIM14_CANTT Probable metalloreductase AIM14 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=AIM14 PE=3 SV=1 117 334 6.0E-11
sp|A3LN69|AIM14_PICST Probable metalloreductase AIM14 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=AIM14 PE=3 SV=2 117 359 2.0E-10
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 145 361 3.0E-10
sp|Q12209|FRE8_YEAST Probable ferric reductase transmembrane component 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE8 PE=1 SV=1 96 361 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94727|FRP2_SCHPO Ferric/cupric reductase transmembrane component 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp2 PE=3 SV=1 145 361 3.0E-13
sp|C5M5S1|AIM14_CANTT Probable metalloreductase AIM14 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=AIM14 PE=3 SV=1 117 334 6.0E-11
sp|A3LN69|AIM14_PICST Probable metalloreductase AIM14 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=AIM14 PE=3 SV=2 117 359 2.0E-10
sp|Q04800|FRP1_SCHPO Ferric reductase transmembrane component 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=frp1 PE=1 SV=1 145 361 3.0E-10
sp|Q12209|FRE8_YEAST Probable ferric reductase transmembrane component 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE8 PE=1 SV=1 96 361 4.0E-10
sp|A5DE11|AIM14_PICGU Probable metalloreductase AIM14 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=AIM14 PE=3 SV=2 144 361 4.0E-09
sp|Q6BM09|AIM14_DEBHA Probable metalloreductase AIM14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=AIM14 PE=3 SV=2 122 359 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 117 136 19
3 146 168 22
4 189 211 22
5 215 237 22
6 244 266 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3567
MGWLYDTSVALSEEQKLVRRQTIDLYACIAHYSALVPPLVLLLVRLVRRAAPLWSPWARRSSPDGHGRYAEVPRS
PIAKAHRRDASGSVTVRWTRLRWWLCDDVYFRGAHWGRREEWLLGFAWALWLLALCVMDTGTDYLHLTKRFGAIA
VSQLPIQFLLALKALNPFAFAFHSSHEDVNRYHRVLGRIVYGLLILHALFYNYFFLVAGIWRKRFFALIVFLGVV
AFAAMSALTTTSLVRVRQYSYRLFFITHLLAAILVPVLIFFHAPSARLYLVETLLIFGLDLAVRKMTTVTSASSF
EVVRGTNLVKISSAIPLRKLANFKARPGSHVYLNVPPRSRPATNRAVFDFLFNPFTCAAGP*
Coding >Hirsu2|3567
ATGGGCTGGCTGTACGACACGTCCGTCGCCCTCTCGGAGGAGCAGAAGCTCGTGCGCCGCCAGACCATCGACCTC
TACGCCTGCATCGCCCACTACTCGGCCCTCGTCCCGCCGCTCGTCCTGCTTCTCGTCCGCCTCGTCCGCCGTGCC
GCCCCCCTTTGGTCGCCGTGGGCCCGCCGCTCCAGTCCGGACGGCCACGGCCGGTATGCCGAGGTGCCGCGCTCG
CCCATTGCCAAAGCTCATCGTCGCGATGCCTCCGGCAGTGTCACCGTCCGCTGGACGAGGCTGCGCTGGTGGCTA
TGTGACGACGTCTACTTTCGCGGCGCGCACTGGGGCCGGCGGGAGGAGTGGCTTCTCGGCTTCGCCTGGGCCCTC
TGGCTGCTGGCCTTGTGCGTGATGGACACGGGCACGGACTATCTGCATCTCACAAAGCGCTTCGGTGCCATAGCC
GTCTCTCAGCTCCCCATCCAGTTTCTTCTAGCTCTCAAGGCCCTGAACCCCTTCGCCTTCGCCTTCCACTCGTCG
CACGAGGACGTTAACCGCTACCACCGTGTCCTCGGCCGCATCGTCTACGGCCTTCTCATCCTCCACGCGCTCTTC
TACAATTACTTCTTCCTCGTCGCCGGCATCTGGCGGAAGCGCTTCTTCGCCCTCATCGTCTTCCTCGGCGTCGTT
GCCTTCGCCGCCATGAGCGCCCTCACGACCACGTCCCTGGTCCGCGTCAGGCAGTACTCGTACCGCCTCTTCTTC
ATCACCCACCTGCTCGCCGCCATACTCGTCCCTGTCCTCATCTTTTTTCACGCTCCGTCTGCCAGACTCTACCTG
GTCGAGACCCTGCTCATCTTCGGTCTTGATCTCGCGGTGCGCAAGATGACGACCGTCACCTCCGCGTCGTCTTTC
GAGGTCGTCCGCGGGACCAACCTCGTCAAGATCTCATCCGCCATCCCGCTTCGCAAGCTGGCCAACTTCAAAGCG
CGCCCCGGGTCACACGTCTACCTCAACGTGCCCCCCCGCAGCCGACCAGCGACCAACAGGGCCGTCTTCGACTTC
CTCTTCAATCCCTTCACCTGCGCAGCGGGCCCATGA
Transcript >Hirsu2|3567
ATGGGCTGGCTGTACGACACGTCCGTCGCCCTCTCGGAGGAGCAGAAGCTCGTGCGCCGCCAGACCATCGACCTC
TACGCCTGCATCGCCCACTACTCGGCCCTCGTCCCGCCGCTCGTCCTGCTTCTCGTCCGCCTCGTCCGCCGTGCC
GCCCCCCTTTGGTCGCCGTGGGCCCGCCGCTCCAGTCCGGACGGCCACGGCCGGTATGCCGAGGTGCCGCGCTCG
CCCATTGCCAAAGCTCATCGTCGCGATGCCTCCGGCAGTGTCACCGTCCGCTGGACGAGGCTGCGCTGGTGGCTA
TGTGACGACGTCTACTTTCGCGGCGCGCACTGGGGCCGGCGGGAGGAGTGGCTTCTCGGCTTCGCCTGGGCCCTC
TGGCTGCTGGCCTTGTGCGTGATGGACACGGGCACGGACTATCTGCATCTCACAAAGCGCTTCGGTGCCATAGCC
GTCTCTCAGCTCCCCATCCAGTTTCTTCTAGCTCTCAAGGCCCTGAACCCCTTCGCCTTCGCCTTCCACTCGTCG
CACGAGGACGTTAACCGCTACCACCGTGTCCTCGGCCGCATCGTCTACGGCCTTCTCATCCTCCACGCGCTCTTC
TACAATTACTTCTTCCTCGTCGCCGGCATCTGGCGGAAGCGCTTCTTCGCCCTCATCGTCTTCCTCGGCGTCGTT
GCCTTCGCCGCCATGAGCGCCCTCACGACCACGTCCCTGGTCCGCGTCAGGCAGTACTCGTACCGCCTCTTCTTC
ATCACCCACCTGCTCGCCGCCATACTCGTCCCTGTCCTCATCTTTTTTCACGCTCCGTCTGCCAGACTCTACCTG
GTCGAGACCCTGCTCATCTTCGGTCTTGATCTCGCGGTGCGCAAGATGACGACCGTCACCTCCGCGTCGTCTTTC
GAGGTCGTCCGCGGGACCAACCTCGTCAAGATCTCATCCGCCATCCCGCTTCGCAAGCTGGCCAACTTCAAAGCG
CGCCCCGGGTCACACGTCTACCTCAACGTGCCCCCCCGCAGCCGACCAGCGACCAACAGGGCCGTCTTCGACTTC
CTCTTCAATCCCTTCACCTGCGCAGCGGGCCCATGA
Gene >Hirsu2|3567
ATGGGCTGGCTGTACGACACGTCCGTCGCCCTCTCGGAGGAGCAGAAGCTCGTGCGCCGCCAGACCATCGACCTC
TACGCCTGCATCGCCCACTACTCGGCCCTCGTCCCGCCGCTCGTCCTGCTTCTCGTCCGCCTCGTCCGCCGTGCC
GCCCCCCTTTGGTCGCCGTGGGCCCGCCGCTCCAGTCCGGACGGCCACGGCCGGTATGCCGAGGTGCCGCGCTCG
CCCATTGCCAAAGCTCATCGTCGCGATGCCTCCGGCAGTGTCACCGTCCGCTGGACGAGGCTGCGCTGGTGGCTA
TGTGACGACGTCTACTTTCGCGGCGCGCACTGGGGCCGGCGGGAGGAGTGGCTTCTCGGCTTCGCCTGGGCCCTC
TGGCTGCTGGCCTTGTGCGTGATGGACACGGGCACGGGTCAGTTCATGTTTCGCTCTCCCAACAAGCCCGATCCC
CTTTTTCGACGCAACGCCCGTCCCCTGAATCGCCTCATCCACCAAGATTCCGAATGCTAACCAAGAAGTCAATCG
TCAGACTATCTGCATCTCACAAAGCGCTTCGGTGCCATAGCCGTCTCTCAGCTCCCCATCCAGTTTCTTCTAGCT
CTCAAGGCCCTGAACCCCTTCGCCTTCGCCTTCCACTCGTCGCACGAGGACGTTAACCGCTACCACCGTGTCCTC
GGCCGCATCGTCTACGGCCTTCTCATCCTCCACGCGCTCTTCTACAATTACTTCTTCCTCGTCGCCGGCATCTGG
CGGAAGCGCTTCTTCGCCCTCATCGTCTTCCTCGGCGTCGTTGCCTTCGCCGCCATGAGCGCCCTCACGACCACG
TCCCTGGTCCGCGTCAGGCAGTACTCGTACCGCCTCTTCTTCATCACCCACCTGCTCGCCGCCATACTCGTCCCT
GTCCTCATCTTTTTTCACGCTCCGTCTGCCAGACTCTACCTGGTCGAGACCCTGCTCATCTTCGGTCTTGATCTC
GCGGTGCGCAAGATGACGACCGTCACCTCCGCGTCGTCTTTCGAGGTCGTCCGCGGGACCAACCTCGTCAAGATC
TCATCCGCCATCCCGCTTCGCAAGCTGGCCAACTTCAAAGCGCGCCCCGGGTCACACGTCTACCTCAACGTGCCC
CCCCGCAGCCGACCAGCGACCAACAGGGCCGTCTTCGACTTCCTCTTCAATCCCTTCACCGTGGCGTCCGTCGAC
GAGGGCCAGGGGACCATGACCCTGGTGGCGCGAGTGCGCAGCGGGCCCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail