Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3565
Gene name
LocationContig_1942:1959..3837
Strand-
Gene length (bp)1878
Transcript length (bp)1878
Coding sequence length (bp)1878
Protein length (aa) 626

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05327 RRN3 RNA polymerase I specific transcription initiation factor RRN3 2.8E-172 4 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10110|RRN3_SCHPO RNA polymerase I-specific transcription initiation factor rrn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrn3 PE=3 SV=1 8 587 7.0E-68
sp|B2RS91|RRN3_MOUSE RNA polymerase I-specific transcription initiation factor RRN3 OS=Mus musculus GN=Rrn3 PE=1 SV=1 67 582 5.0E-51
sp|Q9NYV6|RRN3_HUMAN RNA polymerase I-specific transcription initiation factor RRN3 OS=Homo sapiens GN=RRN3 PE=1 SV=1 46 582 7.0E-48
sp|Q5R4N9|RRN3_PONAB RNA polymerase I-specific transcription initiation factor RRN3 OS=Pongo abelii GN=RRN3 PE=2 SV=1 34 582 2.0E-46
sp|P36070|RRN3_YEAST RNA polymerase I-specific transcription initiation factor RRN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRN3 PE=1 SV=1 148 597 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10110|RRN3_SCHPO RNA polymerase I-specific transcription initiation factor rrn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrn3 PE=3 SV=1 8 587 7.0E-68
sp|B2RS91|RRN3_MOUSE RNA polymerase I-specific transcription initiation factor RRN3 OS=Mus musculus GN=Rrn3 PE=1 SV=1 67 582 5.0E-51
sp|Q9NYV6|RRN3_HUMAN RNA polymerase I-specific transcription initiation factor RRN3 OS=Homo sapiens GN=RRN3 PE=1 SV=1 46 582 7.0E-48
sp|Q5R4N9|RRN3_PONAB RNA polymerase I-specific transcription initiation factor RRN3 OS=Pongo abelii GN=RRN3 PE=2 SV=1 34 582 2.0E-46
sp|P36070|RRN3_YEAST RNA polymerase I-specific transcription initiation factor RRN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRN3 PE=1 SV=1 148 597 5.0E-36
sp|P48322|YPJ1_CAEEL Uncharacterized protein C36E8.1 OS=Caenorhabditis elegans GN=C36E8.1 PE=3 SV=1 76 453 7.0E-11
sp|Q2M238|RN3P1_HUMAN Putative RRN3-like protein RRN3P1 OS=Homo sapiens GN=RRN3P1 PE=5 SV=1 355 506 4.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 92 114 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3565
MADVKLEVRLALEEHLRGNDGQYDSLKELFANDKQRYLPPVVGEDDDTLKPHELQVYVMALTSCIPMLKDKECNG
LVRTVLRCSWLGRDDAFVRVFTHFLAALVSAQGSYLVAVLSMMVDKFRLTRPSSWSVPDFPEIGRDAMRERLHSS
LQYLLQMFPAAAAVLENLLSAKFPFLDESMRTHMAYVRNLVQVKAYVPELRDEILDLILDRLVKMDSQMQVDLED
LDDDVTAAVMYALRDGRRRGLDWEEEEEGDGDGSDSGQDSDNESADSDEQDYDQEAMRVKTVKENVEKMDAVLDT
LFGLYAPHFAQPGSDRAFDMFTVLLREFEQMVLPTYKSRHTQFLIFHFAQRHERLTDAFCGQLMAAAFQGSRPNV
LKQAAAAYLASFVARGAQVPGSLVRTMFLLLLHHLEQYRRRFEPLCRGPDLKRFHPYYSLVQATLYIFCFRWREL
VASAPEAVDPDDAATYVGQELEWIGACQRELSVQLFGKLNPLKVCAPVIVDEFARLAHRLGFLYVYPLVESNKRI
RLSQFLSSTYATGGALRDAGYEAQSESFHQLDPYFPFDPYQLPVSKRWLEGDYVHWESVPGLNAGEDDDSDDTGE
AGGDDEDEEDQDKLEEETATDSDGA*
Coding >Hirsu2|3565
ATGGCCGACGTCAAGCTGGAGGTGCGGCTGGCGCTGGAGGAGCACCTGCGGGGAAACGACGGGCAGTACGACTCG
CTCAAGGAGCTGTTCGCCAACGACAAGCAGAGATACCTGCCGCCGGTGGTGGGCGAGGACGACGACACGCTCAAG
CCGCACGAGCTCCAGGTGTACGTCATGGCGCTGACGAGCTGCATCCCGATGCTCAAGGACAAGGAGTGCAACGGG
CTGGTGCGGACGGTGCTGCGCTGCTCTTGGCTGGGGCGCGACGACGCCTTCGTCCGGGTTTTCACCCACTTTTTG
GCGGCGCTGGTGAGCGCGCAGGGCTCGTACCTGGTGGCGGTCCTGTCGATGATGGTGGACAAGTTCCGGCTCACG
CGGCCGTCGTCGTGGTCGGTGCCCGACTTCCCCGAGATCGGGCGCGACGCGATGCGCGAGCGGCTCCACTCGTCG
CTGCAGTACCTGCTGCAAATGTTCCCGGCGGCGGCGGCGGTGCTGGAGAACCTGCTGAGCGCCAAGTTCCCCTTC
CTGGACGAGTCGATGAGGACGCACATGGCGTACGTGCGGAACCTGGTGCAGGTCAAGGCGTACGTGCCGGAGCTG
CGGGACGAGATCCTGGACCTGATCCTGGACCGGCTCGTCAAGATGGACTCGCAGATGCAGGTGGACCTGGAGGAC
CTGGACGACGACGTGACGGCGGCCGTTATGTACGCGCTGCGCGACGGCCGGCGGCGCGGGCTGGACTGGGAGGAG
GAGGAGGAGGGGGACGGGGACGGGTCGGACTCGGGCCAGGACAGCGACAACGAGTCGGCCGACAGCGACGAGCAG
GACTACGACCAGGAGGCGATGCGGGTCAAGACGGTCAAGGAGAACGTGGAGAAGATGGACGCGGTGCTGGACACG
CTCTTCGGCCTGTACGCGCCGCACTTTGCGCAGCCGGGGTCGGACCGGGCGTTCGACATGTTCACGGTGCTGCTG
CGCGAGTTCGAGCAGATGGTGCTGCCGACGTACAAGTCGCGGCACACGCAGTTCCTCATCTTCCACTTCGCGCAG
CGGCACGAGCGGCTCACGGACGCCTTCTGCGGGCAGCTGATGGCGGCGGCCTTCCAGGGCAGCCGGCCCAACGTG
CTGAAGCAGGCGGCGGCGGCGTACCTGGCCAGCTTCGTGGCGCGGGGCGCGCAGGTGCCGGGCAGCCTGGTGCGG
ACCATGTTCCTGCTGCTGCTGCACCACCTGGAGCAGTACCGGCGGCGGTTCGAGCCGCTGTGCCGCGGGCCGGAC
CTCAAGCGCTTCCACCCGTACTACTCGCTCGTGCAGGCGACGCTGTACATCTTCTGCTTCCGGTGGCGGGAGCTG
GTGGCGTCGGCGCCGGAGGCGGTGGACCCGGACGACGCGGCGACGTACGTCGGCCAGGAGCTGGAGTGGATCGGG
GCGTGCCAGCGCGAGCTGTCGGTGCAGCTGTTCGGCAAGCTGAACCCGCTCAAGGTGTGCGCGCCGGTCATCGTG
GACGAGTTCGCCAGGCTGGCGCACCGGCTCGGCTTCCTGTACGTCTACCCGCTGGTGGAGAGCAACAAGCGGATC
CGGCTGAGCCAGTTCCTGTCGTCGACGTACGCGACGGGCGGCGCGCTGCGCGACGCGGGCTACGAGGCGCAGAGC
GAGAGCTTCCACCAGCTGGACCCGTACTTCCCCTTCGACCCGTACCAGCTGCCGGTCAGCAAGCGGTGGCTGGAG
GGCGACTACGTGCACTGGGAGTCGGTGCCGGGGCTCAACGCCGGCGAGGACGATGACAGCGACGACACGGGCGAG
GCGGGCGGCGACGACGAGGACGAAGAGGACCAGGACAAGCTCGAGGAAGAGACGGCGACGGACAGCGACGGGGCG
TGA
Transcript >Hirsu2|3565
ATGGCCGACGTCAAGCTGGAGGTGCGGCTGGCGCTGGAGGAGCACCTGCGGGGAAACGACGGGCAGTACGACTCG
CTCAAGGAGCTGTTCGCCAACGACAAGCAGAGATACCTGCCGCCGGTGGTGGGCGAGGACGACGACACGCTCAAG
CCGCACGAGCTCCAGGTGTACGTCATGGCGCTGACGAGCTGCATCCCGATGCTCAAGGACAAGGAGTGCAACGGG
CTGGTGCGGACGGTGCTGCGCTGCTCTTGGCTGGGGCGCGACGACGCCTTCGTCCGGGTTTTCACCCACTTTTTG
GCGGCGCTGGTGAGCGCGCAGGGCTCGTACCTGGTGGCGGTCCTGTCGATGATGGTGGACAAGTTCCGGCTCACG
CGGCCGTCGTCGTGGTCGGTGCCCGACTTCCCCGAGATCGGGCGCGACGCGATGCGCGAGCGGCTCCACTCGTCG
CTGCAGTACCTGCTGCAAATGTTCCCGGCGGCGGCGGCGGTGCTGGAGAACCTGCTGAGCGCCAAGTTCCCCTTC
CTGGACGAGTCGATGAGGACGCACATGGCGTACGTGCGGAACCTGGTGCAGGTCAAGGCGTACGTGCCGGAGCTG
CGGGACGAGATCCTGGACCTGATCCTGGACCGGCTCGTCAAGATGGACTCGCAGATGCAGGTGGACCTGGAGGAC
CTGGACGACGACGTGACGGCGGCCGTTATGTACGCGCTGCGCGACGGCCGGCGGCGCGGGCTGGACTGGGAGGAG
GAGGAGGAGGGGGACGGGGACGGGTCGGACTCGGGCCAGGACAGCGACAACGAGTCGGCCGACAGCGACGAGCAG
GACTACGACCAGGAGGCGATGCGGGTCAAGACGGTCAAGGAGAACGTGGAGAAGATGGACGCGGTGCTGGACACG
CTCTTCGGCCTGTACGCGCCGCACTTTGCGCAGCCGGGGTCGGACCGGGCGTTCGACATGTTCACGGTGCTGCTG
CGCGAGTTCGAGCAGATGGTGCTGCCGACGTACAAGTCGCGGCACACGCAGTTCCTCATCTTCCACTTCGCGCAG
CGGCACGAGCGGCTCACGGACGCCTTCTGCGGGCAGCTGATGGCGGCGGCCTTCCAGGGCAGCCGGCCCAACGTG
CTGAAGCAGGCGGCGGCGGCGTACCTGGCCAGCTTCGTGGCGCGGGGCGCGCAGGTGCCGGGCAGCCTGGTGCGG
ACCATGTTCCTGCTGCTGCTGCACCACCTGGAGCAGTACCGGCGGCGGTTCGAGCCGCTGTGCCGCGGGCCGGAC
CTCAAGCGCTTCCACCCGTACTACTCGCTCGTGCAGGCGACGCTGTACATCTTCTGCTTCCGGTGGCGGGAGCTG
GTGGCGTCGGCGCCGGAGGCGGTGGACCCGGACGACGCGGCGACGTACGTCGGCCAGGAGCTGGAGTGGATCGGG
GCGTGCCAGCGCGAGCTGTCGGTGCAGCTGTTCGGCAAGCTGAACCCGCTCAAGGTGTGCGCGCCGGTCATCGTG
GACGAGTTCGCCAGGCTGGCGCACCGGCTCGGCTTCCTGTACGTCTACCCGCTGGTGGAGAGCAACAAGCGGATC
CGGCTGAGCCAGTTCCTGTCGTCGACGTACGCGACGGGCGGCGCGCTGCGCGACGCGGGCTACGAGGCGCAGAGC
GAGAGCTTCCACCAGCTGGACCCGTACTTCCCCTTCGACCCGTACCAGCTGCCGGTCAGCAAGCGGTGGCTGGAG
GGCGACTACGTGCACTGGGAGTCGGTGCCGGGGCTCAACGCCGGCGAGGACGATGACAGCGACGACACGGGCGAG
GCGGGCGGCGACGACGAGGACGAAGAGGACCAGGACAAGCTCGAGGAAGAGACGGCGACGGACAGCGACGGGGCG
TGA
Gene >Hirsu2|3565
ATGGCCGACGTCAAGCTGGAGGTGCGGCTGGCGCTGGAGGAGCACCTGCGGGGAAACGACGGGCAGTACGACTCG
CTCAAGGAGCTGTTCGCCAACGACAAGCAGAGATACCTGCCGCCGGTGGTGGGCGAGGACGACGACACGCTCAAG
CCGCACGAGCTCCAGGTGTACGTCATGGCGCTGACGAGCTGCATCCCGATGCTCAAGGACAAGGAGTGCAACGGG
CTGGTGCGGACGGTGCTGCGCTGCTCTTGGCTGGGGCGCGACGACGCCTTCGTCCGGGTTTTCACCCACTTTTTG
GCGGCGCTGGTGAGCGCGCAGGGCTCGTACCTGGTGGCGGTCCTGTCGATGATGGTGGACAAGTTCCGGCTCACG
CGGCCGTCGTCGTGGTCGGTGCCCGACTTCCCCGAGATCGGGCGCGACGCGATGCGCGAGCGGCTCCACTCGTCG
CTGCAGTACCTGCTGCAAATGTTCCCGGCGGCGGCGGCGGTGCTGGAGAACCTGCTGAGCGCCAAGTTCCCCTTC
CTGGACGAGTCGATGAGGACGCACATGGCGTACGTGCGGAACCTGGTGCAGGTCAAGGCGTACGTGCCGGAGCTG
CGGGACGAGATCCTGGACCTGATCCTGGACCGGCTCGTCAAGATGGACTCGCAGATGCAGGTGGACCTGGAGGAC
CTGGACGACGACGTGACGGCGGCCGTTATGTACGCGCTGCGCGACGGCCGGCGGCGCGGGCTGGACTGGGAGGAG
GAGGAGGAGGGGGACGGGGACGGGTCGGACTCGGGCCAGGACAGCGACAACGAGTCGGCCGACAGCGACGAGCAG
GACTACGACCAGGAGGCGATGCGGGTCAAGACGGTCAAGGAGAACGTGGAGAAGATGGACGCGGTGCTGGACACG
CTCTTCGGCCTGTACGCGCCGCACTTTGCGCAGCCGGGGTCGGACCGGGCGTTCGACATGTTCACGGTGCTGCTG
CGCGAGTTCGAGCAGATGGTGCTGCCGACGTACAAGTCGCGGCACACGCAGTTCCTCATCTTCCACTTCGCGCAG
CGGCACGAGCGGCTCACGGACGCCTTCTGCGGGCAGCTGATGGCGGCGGCCTTCCAGGGCAGCCGGCCCAACGTG
CTGAAGCAGGCGGCGGCGGCGTACCTGGCCAGCTTCGTGGCGCGGGGCGCGCAGGTGCCGGGCAGCCTGGTGCGG
ACCATGTTCCTGCTGCTGCTGCACCACCTGGAGCAGTACCGGCGGCGGTTCGAGCCGCTGTGCCGCGGGCCGGAC
CTCAAGCGCTTCCACCCGTACTACTCGCTCGTGCAGGCGACGCTGTACATCTTCTGCTTCCGGTGGCGGGAGCTG
GTGGCGTCGGCGCCGGAGGCGGTGGACCCGGACGACGCGGCGACGTACGTCGGCCAGGAGCTGGAGTGGATCGGG
GCGTGCCAGCGCGAGCTGTCGGTGCAGCTGTTCGGCAAGCTGAACCCGCTCAAGGTGTGCGCGCCGGTCATCGTG
GACGAGTTCGCCAGGCTGGCGCACCGGCTCGGCTTCCTGTACGTCTACCCGCTGGTGGAGAGCAACAAGCGGATC
CGGCTGAGCCAGTTCCTGTCGTCGACGTACGCGACGGGCGGCGCGCTGCGCGACGCGGGCTACGAGGCGCAGAGC
GAGAGCTTCCACCAGCTGGACCCGTACTTCCCCTTCGACCCGTACCAGCTGCCGGTCAGCAAGCGGTGGCTGGAG
GGCGACTACGTGCACTGGGAGTCGGTGCCGGGGCTCAACGCCGGCGAGGACGATGACAGCGACGACACGGGCGAG
GCGGGCGGCGACGACGAGGACGAAGAGGACCAGGACAAGCTCGAGGAAGAGACGGCGACGGACAGCGACGGGGCG
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail