Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3563
Gene name
LocationContig_1940:746..3268
Strand-
Gene length (bp)2522
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 1.5E-21 209 361
PF01699 Na_Ca_ex Sodium/calcium exchanger protein 2.5E-23 442 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 175 592 3.0E-101
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 148 589 1.0E-81
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 156 589 1.0E-79
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 159 585 7.0E-79
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 191 588 5.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99385|VCX1_YEAST Vacuolar calcium ion transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VCX1 PE=1 SV=1 175 592 3.0E-101
sp|Q8L783|CAX5_ARATH Vacuolar cation/proton exchanger 5 OS=Arabidopsis thaliana GN=CAX5 PE=2 SV=1 148 589 1.0E-81
sp|Q39254|CAX2_ARATH Vacuolar cation/proton exchanger 2 OS=Arabidopsis thaliana GN=CAX2 PE=1 SV=2 156 589 1.0E-79
sp|Q39253|CAX1_ARATH Vacuolar cation/proton exchanger 1 OS=Arabidopsis thaliana GN=CAX1 PE=1 SV=3 159 585 7.0E-79
sp|Q75XW3|CAX_APHHA Ca(2+)/H(+) antiporter OS=Aphanothece halophytica PE=1 SV=1 191 588 5.0E-77
sp|Q5TKG3|CAX1B_ORYSJ Vacuolar cation/proton exchanger 1b OS=Oryza sativa subsp. japonica GN=CAX1b PE=2 SV=1 194 585 2.0E-74
sp|Q93Z81|CAX3_ARATH Vacuolar cation/proton exchanger 3 OS=Arabidopsis thaliana GN=CAX3 PE=1 SV=1 156 585 1.0E-73
sp|Q9LFZ8|CAX6_ARATH Putative vacuolar cation/proton exchanger 6 OS=Arabidopsis thaliana GN=CAX6 PE=3 SV=3 165 589 3.0E-73
sp|Q5KQN0|CAX2_ORYSJ Vacuolar cation/proton exchanger 2 OS=Oryza sativa subsp. japonica GN=CAX2 PE=2 SV=2 175 594 9.0E-71
sp|P74072|CAX_SYNY3 Ca(2+)/H(+) antiporter OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1336 PE=1 SV=1 190 588 8.0E-69
sp|Q769E5|CAX1A_ORYSJ Vacuolar cation/proton exchanger 1a OS=Oryza sativa subsp. japonica GN=CAX1a PE=1 SV=1 167 585 1.0E-68
sp|Q6YXZ1|CAX4_ORYSJ Putative vacuolar cation/proton exchanger 4 OS=Oryza sativa subsp. japonica GN=Os02g0138900 PE=3 SV=1 179 593 5.0E-64
sp|O59768|VCX1_SCHPO Vacuolar calcium ion transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vcx1 PE=3 SV=1 180 589 9.0E-56
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 174 376 3.0E-35
sp|Q6K1C4|CAX3_ORYSJ Vacuolar cation/proton exchanger 3 OS=Oryza sativa subsp. japonica GN=CAX3 PE=2 SV=2 441 589 3.0E-33
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 425 593 3.0E-32
sp|Q9P7B3|YI14_SCHPO Putative cation exchanger C521.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.04c PE=1 SV=1 207 579 1.0E-28
sp|Q945S5|CAX4_ARATH Vacuolar cation/proton exchanger 4 OS=Arabidopsis thaliana GN=CAX4 PE=1 SV=2 177 361 2.0E-28
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 211 373 3.0E-27
sp|P42839|VNX1_YEAST Low affinity vacuolar monovalent cation/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VNX1 PE=1 SV=1 210 587 2.0E-25
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 438 585 2.0E-25
sp|Q5KTQ9|CAX1C_ORYSJ Vacuolar cation/proton exchanger 1c OS=Oryza sativa subsp. japonica GN=CAX1c PE=2 SV=1 176 369 3.0E-22
sp|O34840|CHAA_BACSU Ca(2+)/H(+) antiporter ChaA OS=Bacillus subtilis (strain 168) GN=chaA PE=1 SV=1 440 585 2.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 183 205 22
2 209 228 19
3 241 263 22
4 273 295 22
5 302 324 22
6 339 361 22
7 438 460 22
8 470 489 19
9 506 528 22
10 543 561 18
11 566 588 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3563
MSTLNHFRNRRQAHRFSRASAEQSWNPFRHVAWGPGRHADTWSPGRLEDQREEAEGARAGRADRLTHAATDPVPV
RADSSNAMPGPFKADEAFTQSARKRDSDDKTSSNPSVDTETAGLRNRRPDDETAKSGAAAARPMAPAAAAAADRE
CDADDEKGRKSRFFRHVQPKSPFTAANQLQRTFLNSWINVLLIAAPVGIALNYVGVSKVAVFVVNFVAIIPLAAM
LSFATEEIALRTGETLGGLLNATFGNAVELIVAIIALIDNKVAIVKTSLIGSILSNLLLVMGCCFFFGGLRRPEQ
HFNTTVAQTAASLLALAAASVIVPTVFDQAQDTGPDKVAALSRGTAVILLLVYAAYLFFQLKTHHGVFNEESQKV
PAKPWSRAGISSGAIRQAFVMPGSLMSHGLPDQGENERLSRMLMNPARLDDDDDEEEEPQLHFLVALATLAGSTA
IIALCAEFMVDSIDSVTKNGALSVEFVGLILLPIVGNAAEHATAVTVAIKDKMDLAIGVAIGSSMQIALLLIPLA
VIIGWGQGNDEMNLSFDTFQVATMFAAVLVTNYLIGDGKSHWLEGFLLICLYAIIAVCSFYYPDSATKQ*
Coding >Hirsu2|3563
ATGTCGACCTTAAATCATTTCCGCAACAGGCGCCAGGCGCACCGCTTCAGCCGCGCCAGCGCCGAGCAGTCCTGG
AATCCTTTCCGTCACGTCGCCTGGGGCCCCGGACGCCACGCCGACACCTGGAGCCCCGGCCGCCTGGAGGACCAG
AGAGAGGAAGCCGAGGGCGCGCGAGCAGGCCGAGCCGACCGGCTGACCCACGCCGCCACCGATCCCGTCCCCGTC
CGCGCCGACTCCTCCAACGCCATGCCCGGACCCTTCAAGGCCGACGAAGCCTTCACTCAGTCCGCCCGGAAGCGC
GACAGCGACGACAAGACGTCGTCCAACCCGTCCGTCGACACTGAAACGGCCGGCCTGCGCAACCGCAGACCCGAT
GACGAGACGGCCAAGTCCGGCGCTGCCGCCGCACGCCCCATGGCCCCCGCCGCCGCCGCCGCCGCCGACCGGGAA
TGCGACGCCGACGATGAAAAGGGCCGCAAGAGCCGCTTCTTCCGCCACGTCCAGCCCAAGTCTCCCTTCACCGCC
GCCAACCAGCTGCAGCGGACCTTTCTCAACTCGTGGATCAACGTCCTCCTCATCGCCGCCCCCGTCGGCATCGCC
CTCAACTATGTCGGCGTCTCCAAGGTGGCCGTCTTCGTCGTCAACTTCGTCGCCATCATCCCCCTCGCCGCCATG
CTGAGCTTCGCGACCGAGGAGATCGCCCTGCGCACCGGCGAGACGCTCGGCGGCCTGCTCAACGCCACCTTTGGC
AACGCCGTCGAGCTCATCGTCGCCATCATCGCCCTCATCGACAACAAGGTGGCCATCGTCAAGACGTCGCTCATC
GGCTCCATCCTCTCCAACCTGCTCCTCGTCATGGGCTGCTGCTTCTTCTTCGGCGGCCTGCGCCGGCCCGAGCAG
CACTTCAACACCACCGTCGCCCAGACGGCCGCCTCGCTGCTGGCCCTCGCCGCCGCCTCCGTCATCGTGCCGACC
GTCTTCGACCAGGCCCAGGACACCGGCCCCGACAAGGTGGCCGCCCTGTCCCGCGGCACCGCCGTCATCCTCCTG
CTCGTCTACGCCGCCTACCTCTTCTTCCAGCTCAAGACGCACCACGGCGTCTTCAACGAGGAGAGCCAGAAGGTG
CCGGCCAAGCCGTGGAGCCGCGCTGGCATCAGCTCCGGCGCCATACGCCAGGCCTTCGTCATGCCCGGCTCCCTC
ATGTCCCACGGCCTGCCCGACCAGGGCGAGAACGAGCGCCTGTCGCGGATGCTCATGAACCCGGCCCGCCTCGAC
GACGACGACGACGAAGAGGAGGAGCCGCAGCTGCATTTCCTCGTCGCCCTCGCCACCCTGGCCGGCTCCACCGCC
ATCATCGCCCTCTGCGCCGAGTTCATGGTCGACTCCATCGACTCCGTCACCAAGAACGGCGCCCTGTCCGTCGAG
TTCGTCGGCCTCATCCTGCTGCCCATCGTCGGCAACGCCGCCGAGCACGCCACCGCCGTCACCGTCGCCATCAAG
GACAAGATGGACCTCGCCATCGGCGTCGCCATCGGCTCCAGCATGCAGATCGCCCTGCTCCTCATCCCCCTGGCC
GTCATCATCGGCTGGGGCCAGGGCAACGACGAGATGAACCTGAGCTTCGACACCTTCCAGGTCGCCACCATGTTC
GCCGCCGTGCTGGTGACCAACTATCTCATCGGCGACGGCAAGAGCCACTGGCTCGAGGGCTTCCTGCTCATCTGC
CTCTACGCCATCATCGCCGTCTGCTCGTTCTATTACCCCGACTCGGCCACCAAGCAGTAG
Transcript >Hirsu2|3563
ATGTCGACCTTAAATCATTTCCGCAACAGGCGCCAGGCGCACCGCTTCAGCCGCGCCAGCGCCGAGCAGTCCTGG
AATCCTTTCCGTCACGTCGCCTGGGGCCCCGGACGCCACGCCGACACCTGGAGCCCCGGCCGCCTGGAGGACCAG
AGAGAGGAAGCCGAGGGCGCGCGAGCAGGCCGAGCCGACCGGCTGACCCACGCCGCCACCGATCCCGTCCCCGTC
CGCGCCGACTCCTCCAACGCCATGCCCGGACCCTTCAAGGCCGACGAAGCCTTCACTCAGTCCGCCCGGAAGCGC
GACAGCGACGACAAGACGTCGTCCAACCCGTCCGTCGACACTGAAACGGCCGGCCTGCGCAACCGCAGACCCGAT
GACGAGACGGCCAAGTCCGGCGCTGCCGCCGCACGCCCCATGGCCCCCGCCGCCGCCGCCGCCGCCGACCGGGAA
TGCGACGCCGACGATGAAAAGGGCCGCAAGAGCCGCTTCTTCCGCCACGTCCAGCCCAAGTCTCCCTTCACCGCC
GCCAACCAGCTGCAGCGGACCTTTCTCAACTCGTGGATCAACGTCCTCCTCATCGCCGCCCCCGTCGGCATCGCC
CTCAACTATGTCGGCGTCTCCAAGGTGGCCGTCTTCGTCGTCAACTTCGTCGCCATCATCCCCCTCGCCGCCATG
CTGAGCTTCGCGACCGAGGAGATCGCCCTGCGCACCGGCGAGACGCTCGGCGGCCTGCTCAACGCCACCTTTGGC
AACGCCGTCGAGCTCATCGTCGCCATCATCGCCCTCATCGACAACAAGGTGGCCATCGTCAAGACGTCGCTCATC
GGCTCCATCCTCTCCAACCTGCTCCTCGTCATGGGCTGCTGCTTCTTCTTCGGCGGCCTGCGCCGGCCCGAGCAG
CACTTCAACACCACCGTCGCCCAGACGGCCGCCTCGCTGCTGGCCCTCGCCGCCGCCTCCGTCATCGTGCCGACC
GTCTTCGACCAGGCCCAGGACACCGGCCCCGACAAGGTGGCCGCCCTGTCCCGCGGCACCGCCGTCATCCTCCTG
CTCGTCTACGCCGCCTACCTCTTCTTCCAGCTCAAGACGCACCACGGCGTCTTCAACGAGGAGAGCCAGAAGGTG
CCGGCCAAGCCGTGGAGCCGCGCTGGCATCAGCTCCGGCGCCATACGCCAGGCCTTCGTCATGCCCGGCTCCCTC
ATGTCCCACGGCCTGCCCGACCAGGGCGAGAACGAGCGCCTGTCGCGGATGCTCATGAACCCGGCCCGCCTCGAC
GACGACGACGACGAAGAGGAGGAGCCGCAGCTGCATTTCCTCGTCGCCCTCGCCACCCTGGCCGGCTCCACCGCC
ATCATCGCCCTCTGCGCCGAGTTCATGGTCGACTCCATCGACTCCGTCACCAAGAACGGCGCCCTGTCCGTCGAG
TTCGTCGGCCTCATCCTGCTGCCCATCGTCGGCAACGCCGCCGAGCACGCCACCGCCGTCACCGTCGCCATCAAG
GACAAGATGGACCTCGCCATCGGCGTCGCCATCGGCTCCAGCATGCAGATCGCCCTGCTCCTCATCCCCCTGGCC
GTCATCATCGGCTGGGGCCAGGGCAACGACGAGATGAACCTGAGCTTCGACACCTTCCAGGTCGCCACCATGTTC
GCCGCCGTGCTGGTGACCAACTATCTCATCGGCGACGGCAAGAGCCACTGGCTCGAGGGCTTCCTGCTCATCTGC
CTCTACGCCATCATCGCCGTCTGCTCGTTCTATTACCCCGACTCGGCCACCAAGCAGTAG
Gene >Hirsu2|3563
ATGTCGACCTGTGAGTGCCGTTGATTTTGAGAAAATTGGACCTCGTCTTTCCCTCTGTCTCCTTTTTTTCTGAGA
AAAAAAAAAACACCCACGGCCGTTTGTGTCCACCTGCCTTTTCCATCACAGGCAACATCGCCATCATCACCAGCA
CCCTCATGTTACTACTCCCCATGTCCCCCTCTGCTGCCGAACAGCCAGTGAGCCGGCCGGGCAGGCGCTAGAATC
GGCGCCGCCTCGGCCTTCAAACAAGCTTGCTCGACGGTCGGAACCCAAATAGGGCCCGATTCGTCACCCGTCGCC
ACCCCTTTGTCCCCCTCCTGTTCAGTGCCGTCTTATCCAGGAGACGCGCGCTCGCATCATGATCCTCACCAAGCC
TGCACAGCCCCCCTCCGTTGGCGTACGTGCGCAGTTCAAGAGGCCGGCTCGTCCCTTGGACGCACTCCACCGTCC
CTCTTTACCCTGTCACAAACCTTGGCTTCTCCTAGTCTAAACCTCTTAAGGTCCCGGCGCGACTGCACTCCCCCT
CGGGTCCCTATCCCGTCCTTTTGAGAACAGCCTTCTTCCTCTCGCACTGCCGCCCATGCCCTCGCTCGGCGCCCT
CTCCCTCCCCGTCCTCCCCCGCTTCGCTCCGCCGACGCCGAGCCAGCATCTCTGCCGCGCTGACCAACGACTGCC
ATGGTAGTAAATCATTTCCGCAACAGGCGCCAGGCGCACCGCTTCAGCCGCGCCAGCGCCGAGCAGTCCTGGAAT
CCTTTCCGTCACGTCGCCTGGGGCCCCGGACGCCACGCCGACACCTGGAGCCCCGGCCGCCTGGAGGACCAGAGA
GAGGAAGCCGAGGGCGCGCGAGCAGGCCGAGCCGACCGGCTGACCCACGCCGCCACCGATCCCGTCCCCGTCCGC
GCCGACTCCTCCAACGCCATGCCCGGACCCTTCAAGGCCGACGAAGCCTTCACTCAGTCCGCCCGGAAGCGCGAC
AGCGACGACAAGACGTCGTCCAACCCGTCCGTCGACACTGAAACGGCCGGCCTGCGCAACCGCAGACCCGATGAC
GAGACGGCCAAGTCCGGCGCTGCCGCCGCACGCCCCATGGCCCCCGCCGCCGCCGCCGCCGCCGACCGGGAATGC
GACGCCGACGATGAAAAGGGCCGCAAGAGCCGCTTCTTCCGCCACGTCCAGCCCAAGTCTCCCTTCACCGCCGCC
AACCAGCTGCAGCGGACCTTTCTCAACTCGTGGATCAACGTCCTCCTCATCGCCGCCCCCGTCGGCATCGCCCTC
AACTATGTCGGCGTCTCCAAGGTGGCCGTCTTCGTCGTCAACTTCGTCGCCATCATCCCCCTCGCCGCCATGCTG
AGCTTCGCGACCGAGGAGATCGCCCTGCGCACCGGCGAGACGCTCGGCGGCCTGCTCAACGCCACCTTTGGCAAC
GCCGTCGAGCTCATCGTCGCCATCATCGCCCTCATCGACAACAAGGTGGCCATCGTCAAGACGTCGCTCATCGGC
TCCATCCTCTCCAACCTGCTCCTCGTCATGGGCTGCTGCTTCTTCTTCGGCGGCCTGCGCCGGCCCGAGCAGCAC
TTCAACACCACCGTCGCCCAGACGGCCGCCTCGCTGCTGGCCCTCGCCGCCGCCTCCGTCATCGTGCCGACCGTC
TTCGACCAGGCCCAGGACACCGGCCCCGACAAGGTGGCCGCCCTGTCCCGCGGCACCGCCGTCATCCTCCTGCTC
GTCTACGCCGCCTACCTCTTCTTCCAGCTCAAGACGCACCACGGCGTCTTCAACGAGGAGAGCCAGAAGGTGCCG
GCCAAGCCGTGGAGCCGCGCTGGCATCAGCTCCGGCGCCATACGCCAGGCCTTCGTCATGCCCGGCTCCCTCATG
TCCCACGGCCTGCCCGACCAGGGCGAGAACGAGCGCCTGTCGCGGATGCTCATGAACCCGGCCCGCCTCGACGAC
GACGACGACGAAGAGGAGGAGCCGCAGCTGCATTTCCTCGTCGCCCTCGCCACCCTGGCCGGCTCCACCGCCATC
ATCGCCCTCTGCGCCGAGTTCATGGTCGACTCCATCGACTCCGTCACCAAGAACGGCGCCCTGTCCGTCGAGTTC
GTCGGCCTCATCCTGCTGCCCATCGTCGGCAACGCCGCCGAGCACGCCACCGCCGTCACCGTCGCCATCAAGGAC
AAGATGGACCTCGCCATCGGCGTCGCCATCGGCTCCAGCATGCAGATCGCCCTGCTCCTCATCCCCCTGGCCGTC
ATCATCGGCTGGGGCCAGGGCAACGACGAGATGAACCTGAGCTTCGACACCTTCCAGGTCGCCACCATGTTCGCC
GCCGTGCTGGTGACCAACTATCTCATCGGCGACGGCAAGAGCCACTGGCTCGAGGGCTTCCTGCTCATCTGCCTC
TACGCCATCATCGCCGTCTGCTCGTTCTGTGAGTCTCACCCTGGACGTTTTGCCCCAGCTCTCCGGCGCGCGATT
GCTGACCCGCCCTTGTAGATTACCCCGACTCGGCCACCAAGCAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail