Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3559
Gene name
LocationContig_194:17226..22275
Strand+
Gene length (bp)5049
Transcript length (bp)4731
Coding sequence length (bp)4731
Protein length (aa) 1577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 8.6E-25 487 619
PF00005 ABC_tran ABC transporter 3.7E-25 1257 1395
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 3.5E-12 955 1185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 993 1561 2.0E-47
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 993 1561 9.0E-47
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 993 1564 7.0E-46
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 993 1562 1.0E-45
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 994 1560 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 993 1561 2.0E-47
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 993 1561 9.0E-47
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 993 1564 7.0E-46
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 993 1562 1.0E-45
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 994 1560 2.0E-45
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 1220 1564 2.0E-45
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 128 855 3.0E-45
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 993 1564 3.0E-45
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 993 1556 1.0E-44
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 175 769 3.0E-44
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 217 772 7.0E-44
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 441 686 7.0E-44
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 464 695 9.0E-44
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 217 686 1.0E-43
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 1226 1557 1.0E-43
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 222 684 2.0E-43
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 1241 1552 2.0E-43
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 1241 1552 3.0E-43
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 175 755 3.0E-43
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 1227 1572 6.0E-43
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 1227 1563 6.0E-43
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 1220 1555 7.0E-43
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 484 684 1.0E-42
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 306 684 2.0E-42
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 993 1457 2.0E-42
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 1238 1563 2.0E-42
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 1220 1561 2.0E-42
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 1251 1568 5.0E-42
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 1201 1556 6.0E-42
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 441 686 6.0E-42
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 219 762 6.0E-42
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 1218 1568 1.0E-41
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 217 772 1.0E-41
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 968 1557 1.0E-41
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 484 725 2.0E-41
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 478 750 2.0E-41
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 485 695 3.0E-41
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 484 725 4.0E-41
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 309 752 5.0E-41
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 484 695 5.0E-41
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 444 755 8.0E-41
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 306 684 4.0E-40
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 1159 1562 5.0E-40
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 981 1567 1.0E-39
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 1255 1564 1.0E-39
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 1255 1564 1.0E-39
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 479 773 1.0E-39
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 479 773 1.0E-39
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 468 753 1.0E-39
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 1213 1561 2.0E-39
sp|Q9FKF2|AB11A_ARATH ABC transporter A family member 11 OS=Arabidopsis thaliana GN=ABCA11 PE=3 SV=1 468 753 2.0E-39
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 451 684 3.0E-39
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 981 1567 4.0E-39
sp|Q9FLT5|AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana GN=ABCA9 PE=1 SV=1 468 753 4.0E-39
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 479 764 6.0E-39
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 960 1562 7.0E-39
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 175 755 9.0E-39
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 479 684 2.0E-38
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 1235 1555 3.0E-38
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 484 768 4.0E-38
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 1255 1576 6.0E-38
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 1255 1574 8.0E-38
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 454 759 1.0E-37
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 187 755 2.0E-37
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 1255 1562 3.0E-37
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 482 724 3.0E-37
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 1246 1557 4.0E-37
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 1220 1555 4.0E-37
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 478 769 4.0E-37
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 1255 1554 5.0E-37
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 1223 1552 9.0E-37
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 1243 1567 1.0E-36
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 485 768 1.0E-36
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 445 684 1.0E-36
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 1208 1560 3.0E-36
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 1254 1559 3.0E-36
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 1255 1569 4.0E-36
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 482 724 4.0E-36
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 478 752 4.0E-36
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 1232 1561 5.0E-36
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 1254 1568 5.0E-36
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 1255 1555 5.0E-36
sp|Q9FKF2|AB11A_ARATH ABC transporter A family member 11 OS=Arabidopsis thaliana GN=ABCA11 PE=3 SV=1 1254 1559 6.0E-36
sp|Q9FLT5|AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana GN=ABCA9 PE=1 SV=1 1254 1559 6.0E-36
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 484 712 6.0E-36
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 192 686 7.0E-36
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 1248 1553 7.0E-36
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 1265 1568 1.0E-35
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 1003 1562 1.0E-35
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 482 724 2.0E-35
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 1255 1554 2.0E-35
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 1254 1554 2.0E-35
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 1255 1554 2.0E-35
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 471 684 4.0E-35
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 1206 1552 4.0E-35
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 1227 1562 6.0E-35
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 485 684 6.0E-35
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 1255 1573 8.0E-35
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 1001 1455 9.0E-35
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 482 724 9.0E-35
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 476 753 1.0E-34
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 443 770 1.0E-34
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 1213 1556 1.0E-34
sp|Q54DT1|ABCA9_DICDI ABC transporter A family member 9 OS=Dictyostelium discoideum GN=abcA9 PE=3 SV=1 451 752 1.0E-34
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 1253 1574 2.0E-34
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 1223 1557 2.0E-34
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 1255 1554 2.0E-34
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 1003 1555 7.0E-34
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 472 753 1.0E-33
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 196 760 2.0E-33
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 1255 1564 2.0E-33
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 472 753 2.0E-33
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 472 750 2.0E-33
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 1246 1438 2.0E-33
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 476 753 3.0E-33
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 1003 1552 3.0E-33
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 1255 1557 4.0E-33
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 1255 1569 5.0E-33
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 1255 1554 6.0E-33
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 1229 1561 6.0E-33
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 480 722 6.0E-33
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 1255 1555 7.0E-33
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 1228 1562 7.0E-33
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 472 753 1.0E-32
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 482 684 1.0E-32
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 1226 1550 1.0E-32
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 443 770 2.0E-32
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 443 765 2.0E-32
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 970 1461 2.0E-32
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 482 724 2.0E-32
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 472 753 3.0E-32
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 1228 1562 4.0E-32
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 1245 1453 4.0E-32
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 1245 1453 7.0E-32
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 1245 1453 8.0E-32
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 1255 1552 8.0E-32
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 1245 1453 8.0E-32
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 1245 1453 8.0E-32
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 1245 1453 1.0E-31
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 1227 1562 2.0E-31
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 1206 1555 2.0E-31
sp|Q54DT1|ABCA9_DICDI ABC transporter A family member 9 OS=Dictyostelium discoideum GN=abcA9 PE=3 SV=1 1255 1552 6.0E-31
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 482 682 7.0E-31
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 1246 1455 1.0E-30
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 1246 1453 1.0E-30
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 1246 1453 1.0E-30
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 1246 1432 2.0E-30
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 446 761 2.0E-30
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 1001 1461 3.0E-30
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 1255 1552 4.0E-30
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 1240 1451 6.0E-30
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 1205 1438 6.0E-30
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 1227 1562 2.0E-29
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 1252 1552 2.0E-29
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 313 686 3.0E-29
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 1246 1438 6.0E-29
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 476 753 7.0E-29
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 1246 1451 2.0E-28
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 478 773 2.0E-28
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 479 747 2.0E-28
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 1240 1451 3.0E-28
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 1199 1455 3.0E-28
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 1229 1564 4.0E-28
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 1241 1465 4.0E-28
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 479 747 6.0E-28
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 484 676 8.0E-28
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 483 747 8.0E-28
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 478 745 2.0E-27
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 483 747 3.0E-27
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 484 751 5.0E-27
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 1243 1438 5.0E-27
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 1246 1552 8.0E-27
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 1240 1438 8.0E-27
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 483 747 1.0E-26
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 472 686 1.0E-26
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 478 749 2.0E-26
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 486 751 2.0E-26
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 484 676 2.0E-26
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 1246 1451 3.0E-26
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 1243 1454 4.0E-26
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 478 777 4.0E-26
sp|Q46YX6|NODI_CUPPJ Nod factor export ATP-binding protein I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nodI PE=3 SV=1 1240 1451 5.0E-26
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 478 749 8.0E-26
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 478 749 8.0E-26
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 486 676 9.0E-26
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 1218 1457 1.0E-25
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 1218 1457 1.0E-25
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 486 751 2.0E-25
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 1240 1466 2.0E-25
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 1246 1454 3.0E-25
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 484 751 4.0E-25
sp|P9WQL9|DRRA_MYCTU Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=drrA PE=1 SV=1 483 747 4.0E-25
sp|P9WQL8|DRRA_MYCTO Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=drrA PE=3 SV=1 483 747 4.0E-25
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 471 747 4.0E-25
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 1251 1441 5.0E-25
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 228 752 7.0E-25
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 484 672 7.0E-25
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 484 672 7.0E-25
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 484 672 7.0E-25
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 484 751 8.0E-25
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 486 682 9.0E-25
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 481 751 1.0E-24
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 471 747 1.0E-24
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 484 751 2.0E-24
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 481 751 2.0E-24
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 1248 1479 2.0E-24
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 478 749 3.0E-24
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 485 686 7.0E-24
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 1214 1453 8.0E-24
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 486 749 1.0E-23
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 441 752 1.0E-23
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 446 752 1.0E-23
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 484 676 2.0E-23
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 486 676 2.0E-23
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 1212 1454 2.0E-23
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 1241 1453 2.0E-23
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 484 751 4.0E-23
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 485 681 4.0E-23
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 484 751 5.0E-23
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 485 747 7.0E-23
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 485 679 1.0E-22
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 982 1562 1.0E-22
sp|P9WQL9|DRRA_MYCTU Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=drrA PE=1 SV=1 1246 1463 2.0E-22
sp|P9WQL8|DRRA_MYCTO Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=drrA PE=3 SV=1 1246 1463 2.0E-22
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 1241 1440 2.0E-22
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 1241 1471 2.0E-22
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 1254 1463 3.0E-22
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 485 679 4.0E-22
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 485 679 4.0E-22
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 1254 1441 5.0E-22
sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1 480 681 6.0E-22
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 485 747 8.0E-22
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 486 671 9.0E-22
sp|P54591|YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1 485 681 9.0E-22
sp|P25885|Y382_RHIME Uncharacterized ABC transporter ATP-binding protein R00382 OS=Rhizobium meliloti (strain 1021) GN=R00382 PE=3 SV=1 463 676 1.0E-21
sp|A1TAI4|POTA_MYCVP Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=potA PE=3 SV=1 1240 1493 1.0E-21
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 1240 1459 1.0E-21
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 1254 1441 2.0E-21
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 1241 1459 2.0E-21
sp|P42332|BCRA_BACLI Bacitracin transport ATP-binding protein BcrA OS=Bacillus licheniformis GN=bcrA PE=3 SV=1 1238 1438 2.0E-21
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 1245 1451 3.0E-21
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 1243 1447 3.0E-21
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 483 663 8.0E-21
sp|Q3IM36|PSTB3_NATPD Phosphate import ATP-binding protein PstB 3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB3 PE=3 SV=1 1232 1437 1.0E-20
sp|Q1B8V9|POTA_MYCSS Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain MCS) GN=potA PE=3 SV=1 1228 1493 1.0E-20
sp|A1UG51|POTA_MYCSK Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain KMS) GN=potA PE=3 SV=1 1228 1493 1.0E-20
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 1240 1438 1.0E-20
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 1241 1440 2.0E-20
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 1241 1438 2.0E-20
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 1240 1440 2.0E-20
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 1241 1438 2.0E-20
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 485 731 2.0E-20
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 1243 1459 2.0E-20
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 1243 1459 2.0E-20
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 1243 1459 2.0E-20
sp|Q46YX6|NODI_CUPPJ Nod factor export ATP-binding protein I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nodI PE=3 SV=1 483 682 3.0E-20
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 1245 1440 3.0E-20
sp|P26946|Y2279_BACPE Uncharacterized ABC transporter ATP-binding protein BpOF4_11395 OS=Bacillus pseudofirmus (strain OF4) GN=BpOF4_11395 PE=3 SV=2 501 749 3.0E-20
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 1240 1457 3.0E-20
sp|P0A2V9|PSTB3_STRR6 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB3 PE=1 SV=1 1243 1436 3.0E-20
sp|P0A2V8|PSTB3_STRPN Phosphate import ATP-binding protein PstB 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB3 PE=3 SV=1 1243 1436 3.0E-20
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 1241 1528 3.0E-20
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 483 667 4.0E-20
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 483 663 4.0E-20
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 1241 1451 5.0E-20
sp|Q9KU04|PSTB1_VIBCH Phosphate import ATP-binding protein PstB 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pstB1 PE=3 SV=1 1241 1451 5.0E-20
sp|Q8ZPK4|OSMV_SALTY Osmoprotectant import ATP-binding protein OsmV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=osmV PE=1 SV=1 481 676 5.0E-20
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 496 680 5.0E-20
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 1238 1451 6.0E-20
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 1241 1453 6.0E-20
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 1241 1440 6.0E-20
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 1245 1440 7.0E-20
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 1241 1453 7.0E-20
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 484 679 9.0E-20
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 1238 1451 1.0E-19
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 1245 1454 1.0E-19
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 481 753 1.0E-19
sp|Q9KHT9|OPUCA_LISMN Carnitine transport ATP-binding protein OpuCA OS=Listeria monocytogenes GN=opuCA PE=1 SV=1 485 766 1.0E-19
sp|G2JZ44|OPUCA_LISM4 Carnitine transport ATP-binding protein OpuCA OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=opuCA PE=1 SV=1 485 766 1.0E-19
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 477 671 2.0E-19
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 1241 1440 2.0E-19
sp|Q92SA1|PSTB_RHIME Phosphate import ATP-binding protein PstB OS=Rhizobium meliloti (strain 1021) GN=pstB PE=3 SV=1 1224 1437 2.0E-19
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 1240 1459 2.0E-19
sp|P54592|YHCH_BACSU Uncharacterized ABC transporter ATP-binding protein YhcH OS=Bacillus subtilis (strain 168) GN=yhcH PE=3 SV=1 1240 1440 2.0E-19
sp|P19844|NOSF_PSEST Copper transport ATP-binding protein NosF OS=Pseudomonas stutzeri GN=nosF PE=3 SV=1 1246 1452 2.0E-19
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 1240 1439 2.0E-19
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 1240 1440 2.0E-19
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 1240 1432 2.0E-19
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 1240 1432 2.0E-19
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 477 672 3.0E-19
sp|Q8RFN2|METN_FUSNN Methionine import ATP-binding protein MetN OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=metN PE=3 SV=1 1240 1439 3.0E-19
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 1245 1459 3.0E-19
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 1243 1451 3.0E-19
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 1240 1451 3.0E-19
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 485 681 4.0E-19
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 1237 1459 4.0E-19
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 1240 1440 4.0E-19
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 1240 1440 4.0E-19
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 1240 1440 4.0E-19
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 1241 1440 4.0E-19
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 1241 1457 4.0E-19
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 1241 1451 4.0E-19
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 485 676 4.0E-19
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 1233 1459 5.0E-19
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 1252 1441 5.0E-19
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 1240 1459 5.0E-19
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 1241 1514 6.0E-19
sp|Q2G607|PSTB_NOVAD Phosphate import ATP-binding protein PstB OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pstB PE=3 SV=1 1245 1436 6.0E-19
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 1248 1459 6.0E-19
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 1240 1440 6.0E-19
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 1240 1440 7.0E-19
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 1241 1453 7.0E-19
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 1241 1454 7.0E-19
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 1238 1451 8.0E-19
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 1241 1454 9.0E-19
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 1245 1451 1.0E-18
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 1241 1451 1.0E-18
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 1240 1439 1.0E-18
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 1240 1439 1.0E-18
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 1240 1439 1.0E-18
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 1240 1439 1.0E-18
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 1240 1439 1.0E-18
sp|Q2FTF8|PSTB_METHJ Phosphate import ATP-binding protein PstB OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pstB PE=3 SV=1 1250 1453 1.0E-18
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 1240 1451 1.0E-18
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 495 679 2.0E-18
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 1240 1439 2.0E-18
sp|Q58418|PSTB_METJA Phosphate import ATP-binding protein PstB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pstB PE=3 SV=1 1250 1451 2.0E-18
sp|P33360|YEHX_ECOLI Glycine betaine uptake system ATP-binding protein YehX OS=Escherichia coli (strain K12) GN=yehX PE=1 SV=1 1245 1438 2.0E-18
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 1231 1459 2.0E-18
sp|Q5E3B8|PSTB2_VIBF1 Phosphate import ATP-binding protein PstB 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pstB2 PE=3 SV=1 1249 1451 2.0E-18
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 485 679 2.0E-18
sp|Q1R0Z6|PHNC_CHRSD Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1 1240 1418 2.0E-18
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 1245 1455 2.0E-18
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 1241 1489 2.0E-18
sp|Q7MPC5|THIQ_VIBVY Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain YJ016) GN=thiQ PE=3 SV=1 496 680 3.0E-18
sp|Q8DE95|THIQ_VIBVU Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain CMCP6) GN=thiQ PE=3 SV=1 496 680 3.0E-18
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 485 677 3.0E-18
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 1238 1440 3.0E-18
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 485 677 3.0E-18
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 1240 1438 3.0E-18
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 1240 1457 3.0E-18
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 1240 1460 3.0E-18
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 1240 1438 3.0E-18
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 1251 1438 3.0E-18
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 1241 1489 3.0E-18
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 1241 1489 3.0E-18
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 1240 1439 3.0E-18
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 484 679 3.0E-18
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 1241 1454 3.0E-18
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 1243 1451 4.0E-18
sp|Q6A6X6|METN_PROAC Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1 1245 1439 4.0E-18
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 1243 1484 4.0E-18
sp|O34946|ZNUC_BACSU High-affinity zinc uptake system ATP-binding protein ZnuC OS=Bacillus subtilis (strain 168) GN=znuC PE=1 SV=1 485 665 4.0E-18
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 1251 1438 4.0E-18
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 486 665 4.0E-18
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 1258 1423 4.0E-18
sp|Q2W8B4|PSTB1_MAGSA Phosphate import ATP-binding protein PstB 1 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB1 PE=3 SV=1 1237 1451 4.0E-18
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 1245 1485 4.0E-18
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 1238 1437 4.0E-18
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 471 672 4.0E-18
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 1245 1454 5.0E-18
sp|Q6XYT0|PSTB_SPIKU Phosphate import ATP-binding protein PstB OS=Spiroplasma kunkelii GN=pstB PE=3 SV=1 1239 1457 5.0E-18
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 1241 1454 5.0E-18
sp|P54591|YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1 1241 1454 5.0E-18
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 483 663 5.0E-18
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 483 667 7.0E-18
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 484 676 7.0E-18
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 1238 1440 7.0E-18
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 1255 1456 7.0E-18
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 484 679 8.0E-18
sp|Q72GX5|PSTB_THET2 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pstB PE=3 SV=1 1225 1435 8.0E-18
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 484 683 9.0E-18
sp|Q87SV4|THIQ_VIBPA Thiamine import ATP-binding protein ThiQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiQ PE=3 SV=1 1261 1451 9.0E-18
sp|P54592|YHCH_BACSU Uncharacterized ABC transporter ATP-binding protein YhcH OS=Bacillus subtilis (strain 168) GN=yhcH PE=3 SV=1 486 750 9.0E-18
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 1241 1447 9.0E-18
sp|Q2KCV5|PSTB_RHIEC Phosphate import ATP-binding protein PstB OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pstB PE=3 SV=1 1227 1437 1.0E-17
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 1241 1440 1.0E-17
sp|Q2IGQ6|PSTB_ANADE Phosphate import ATP-binding protein PstB OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pstB PE=3 SV=1 1245 1451 1.0E-17
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 484 679 1.0E-17
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 1240 1439 1.0E-17
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 1223 1444 1.0E-17
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 1223 1444 1.0E-17
sp|A1TAI4|POTA_MYCVP Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=potA PE=3 SV=1 484 679 1.0E-17
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 1223 1444 1.0E-17
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 1223 1444 1.0E-17
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 1238 1437 1.0E-17
sp|Q03A07|METN_LACC3 Methionine import ATP-binding protein MetN OS=Lactobacillus casei (strain ATCC 334) GN=metN PE=3 SV=1 1254 1438 1.0E-17
sp|Q8E9I8|PSTB2_SHEON Phosphate import ATP-binding protein PstB 2 OS=Shewanella oneidensis (strain MR-1) GN=pstB2 PE=3 SV=1 1241 1436 1.0E-17
sp|A0LUE6|POTA_ACIC1 Spermidine/putrescine import ATP-binding protein PotA OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=potA PE=3 SV=1 483 676 1.0E-17
sp|Q1AS06|POTA_RUBXD Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1 1241 1467 1.0E-17
sp|Q0C0L5|PSTB_HYPNA Phosphate import ATP-binding protein PstB OS=Hyphomonas neptunium (strain ATCC 15444) GN=pstB PE=3 SV=1 1221 1459 1.0E-17
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 1241 1453 1.0E-17
sp|Q4L691|PSTB_STAHJ Phosphate import ATP-binding protein PstB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pstB PE=3 SV=1 1250 1436 1.0E-17
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 1241 1457 1.0E-17
sp|Q8G5P8|METN_BIFLO Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1 1245 1439 1.0E-17
sp|Q6AM16|PSTB_DESPS Phosphate import ATP-binding protein PstB OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pstB PE=3 SV=1 1250 1451 1.0E-17
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 485 679 1.0E-17
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 483 663 1.0E-17
sp|Q7MPC5|THIQ_VIBVY Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain YJ016) GN=thiQ PE=3 SV=1 1266 1457 2.0E-17
sp|Q8DE95|THIQ_VIBVU Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain CMCP6) GN=thiQ PE=3 SV=1 1266 1457 2.0E-17
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 1225 1452 2.0E-17
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 489 665 2.0E-17
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 1241 1440 2.0E-17
sp|Q82TL6|POTA_NITEU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=potA PE=3 SV=1 1240 1438 2.0E-17
sp|Q73P71|PHNC_TREDE Phosphonates import ATP-binding protein PhnC OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=phnC PE=3 SV=1 1240 1439 2.0E-17
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 1240 1447 2.0E-17
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 1254 1468 2.0E-17
sp|Q3IS07|PSTB1_NATPD Phosphate import ATP-binding protein PstB 1 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB1 PE=3 SV=1 1236 1437 2.0E-17
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 1241 1454 2.0E-17
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 480 681 2.0E-17
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 1241 1454 2.0E-17
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 1241 1454 2.0E-17
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 1241 1454 2.0E-17
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 1240 1434 2.0E-17
sp|P63362|PSTB_BRUSU Phosphate import ATP-binding protein PstB OS=Brucella suis biovar 1 (strain 1330) GN=pstB PE=3 SV=1 1227 1451 2.0E-17
sp|P63361|PSTB_BRUME Phosphate import ATP-binding protein PstB OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pstB PE=3 SV=1 1227 1451 2.0E-17
sp|Q57AC2|PSTB_BRUAB Phosphate import ATP-binding protein PstB OS=Brucella abortus biovar 1 (strain 9-941) GN=pstB PE=3 SV=1 1227 1451 2.0E-17
sp|Q2YQT8|PSTB_BRUA2 Phosphate import ATP-binding protein PstB OS=Brucella abortus (strain 2308) GN=pstB PE=3 SV=2 1227 1451 2.0E-17
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 1240 1439 2.0E-17
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 481 676 2.0E-17
sp|Q1MLW4|PSTB1_RHIL3 Phosphate import ATP-binding protein PstB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pstB1 PE=3 SV=1 1246 1437 2.0E-17
sp|O51587|POTA_BORBU Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=potA PE=3 SV=1 1253 1451 2.0E-17
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 1244 1447 2.0E-17
sp|Q5PDF8|THIQ_SALPA Thiamine import ATP-binding protein ThiQ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thiQ PE=3 SV=1 1260 1439 2.0E-17
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 484 679 2.0E-17
sp|Q57TF5|THIQ_SALCH Thiamine import ATP-binding protein ThiQ OS=Salmonella choleraesuis (strain SC-B67) GN=thiQ PE=3 SV=1 1260 1439 2.0E-17
sp|Q6LV32|THIQ_PHOPR Thiamine import ATP-binding protein ThiQ OS=Photobacterium profundum GN=thiQ PE=3 SV=2 1265 1451 2.0E-17
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 1240 1457 2.0E-17
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 1236 1444 2.0E-17
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 1225 1452 3.0E-17
sp|Q1M8E0|METN_RHIL3 Methionine import ATP-binding protein MetN OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=metN PE=3 SV=2 1224 1438 3.0E-17
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 481 680 3.0E-17
sp|Q8Z9I6|THIQ_SALTI Thiamine import ATP-binding protein ThiQ OS=Salmonella typhi GN=thiQ PE=3 SV=1 1260 1439 3.0E-17
sp|Q8UI76|PSTB_AGRFC Phosphate import ATP-binding protein PstB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pstB PE=3 SV=1 1224 1437 3.0E-17
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 465 676 3.0E-17
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 1241 1438 3.0E-17
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 1241 1457 3.0E-17
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 1241 1457 3.0E-17
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 1246 1453 3.0E-17
sp|Q1QVQ7|METN_CHRSD Methionine import ATP-binding protein MetN OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metN PE=3 SV=1 1240 1439 3.0E-17
sp|P0C0E9|ECFA_STRPY Energy-coupling factor transporter ATP-binding protein EcfA OS=Streptococcus pyogenes GN=ecfA PE=3 SV=1 479 676 3.0E-17
sp|P0CZ29|ECFA1_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA1 PE=3 SV=1 479 676 3.0E-17
sp|A2RH11|ECFA1_STRPG Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA1 PE=3 SV=1 479 676 3.0E-17
sp|Q1J449|ECFA1_STRPF Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA1 PE=3 SV=2 479 676 3.0E-17
sp|Q1JEC8|ECFA1_STRPD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA1 PE=3 SV=2 479 676 3.0E-17
sp|Q7CMM7|ECFA1_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA1 PE=3 SV=2 479 676 3.0E-17
sp|Q5X9B5|ECFA1_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA1 PE=3 SV=2 479 676 3.0E-17
sp|P0CZ28|ECFA1_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA1 PE=3 SV=1 479 676 3.0E-17
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 1241 1438 3.0E-17
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 486 672 3.0E-17
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 1241 1459 3.0E-17
sp|P69880|PSTB_STAAW Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain MW2) GN=pstB PE=3 SV=1 1250 1436 3.0E-17
sp|Q6G9H4|PSTB_STAAS Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain MSSA476) GN=pstB PE=3 SV=1 1250 1436 3.0E-17
sp|P69879|PSTB_STAAN Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain N315) GN=pstB PE=3 SV=1 1250 1436 3.0E-17
sp|P69878|PSTB_STAAM Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pstB PE=3 SV=1 1250 1436 3.0E-17
sp|P69881|PSTB_STAAC Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain COL) GN=pstB PE=3 SV=1 1250 1436 3.0E-17
sp|Q2FYQ0|PSTB_STAA8 Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain NCTC 8325) GN=pstB PE=3 SV=1 1250 1436 3.0E-17
sp|Q2FH51|PSTB_STAA3 Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain USA300) GN=pstB PE=3 SV=1 1250 1436 3.0E-17
sp|Q0AGF4|POTA_NITEC Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas eutropha (strain C91) GN=potA PE=3 SV=1 1240 1438 3.0E-17
sp|Q48QM2|ECFA1_STRPM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA1 PE=3 SV=2 479 676 3.0E-17
sp|Q1JJC9|ECFA1_STRPC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA1 PE=3 SV=2 479 676 3.0E-17
sp|P0C0E8|ECFA1_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M1 GN=ecfA1 PE=3 SV=1 479 676 3.0E-17
sp|Q660M8|POTA_BORBP Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=potA PE=3 SV=1 1253 1451 3.0E-17
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 481 676 4.0E-17
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 1243 1453 4.0E-17
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 1236 1440 4.0E-17
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 1240 1467 4.0E-17
sp|Q49XI8|PSTB_STAS1 Phosphate import ATP-binding protein PstB OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pstB PE=3 SV=1 1250 1436 4.0E-17
sp|Q87UH7|TAUB_PSESM Taurine import ATP-binding protein TauB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tauB PE=3 SV=1 497 663 4.0E-17
sp|Q6GH21|PSTB_STAAR Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain MRSA252) GN=pstB PE=3 SV=1 1250 1436 4.0E-17
sp|Q2YXY2|PSTB_STAAB Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pstB PE=3 SV=1 1250 1436 4.0E-17
sp|Q2W7J9|PSTB2_MAGSA Phosphate import ATP-binding protein PstB 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB2 PE=3 SV=1 1250 1451 4.0E-17
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 1241 1438 4.0E-17
sp|Q24QI5|METN_DESHY Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1 1240 1444 4.0E-17
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 1237 1440 4.0E-17
sp|Q92N13|HMUV_RHIME Hemin import ATP-binding protein HmuV OS=Rhizobium meliloti (strain 1021) GN=hmuV PE=3 SV=1 486 676 5.0E-17
sp|P75444|Y334_MYCPN Putative ABC transporter ATP-binding protein MPN_334 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_334 PE=3 SV=1 1240 1438 5.0E-17
sp|Q8ETV6|ECFA2_OCEIH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ecfA2 PE=3 SV=1 1253 1454 5.0E-17
sp|Q1J982|ECFA1_STRPB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA1 PE=3 SV=2 479 676 5.0E-17
sp|A1JRI2|ZNUC_YERE8 Zinc import ATP-binding protein ZnuC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=znuC PE=3 SV=1 1238 1426 5.0E-17
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 484 676 5.0E-17
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 1255 1438 5.0E-17
sp|Q0SML1|POTA_BORAP Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia afzelii (strain PKo) GN=potA PE=3 SV=1 1253 1451 5.0E-17
sp|Q6LSC4|PSTB2_PHOPR Phosphate import ATP-binding protein PstB 2 OS=Photobacterium profundum GN=pstB2 PE=3 SV=1 1250 1436 5.0E-17
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 489 676 5.0E-17
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 481 676 5.0E-17
sp|Q9L1C3|METN_STRCO Methionine import ATP-binding protein MetN OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metN PE=3 SV=2 479 676 5.0E-17
sp|Q8ZRV2|THIQ_SALTY Thiamine import ATP-binding protein ThiQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiQ PE=1 SV=1 1260 1439 5.0E-17
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 1240 1438 5.0E-17
sp|Q3ILC5|PSTB_PSEHT Phosphate import ATP-binding protein PstB OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pstB PE=3 SV=1 1250 1438 5.0E-17
sp|Q87S48|PSTB1_VIBPA Phosphate import ATP-binding protein PstB 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pstB1 PE=3 SV=1 1250 1438 5.0E-17
sp|Q5V0G3|PSTB2_HALMA Phosphate import ATP-binding protein PstB 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pstB2 PE=3 SV=1 1219 1437 6.0E-17
sp|Q5SLN1|PSTB_THET8 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pstB PE=3 SV=1 1240 1435 6.0E-17
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 497 663 6.0E-17
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 1241 1440 6.0E-17
sp|Q73GK9|ZNUC_WOLPM Zinc import ATP-binding protein ZnuC OS=Wolbachia pipientis wMel GN=znuC PE=3 SV=2 1240 1428 6.0E-17
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 485 676 6.0E-17
sp|Q9KHT9|OPUCA_LISMN Carnitine transport ATP-binding protein OpuCA OS=Listeria monocytogenes GN=opuCA PE=1 SV=1 1240 1438 6.0E-17
sp|G2JZ44|OPUCA_LISM4 Carnitine transport ATP-binding protein OpuCA OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=opuCA PE=1 SV=1 1240 1438 6.0E-17
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 469 676 6.0E-17
sp|Q98DA2|METN_RHILO Methionine import ATP-binding protein MetN OS=Rhizobium loti (strain MAFF303099) GN=metN PE=3 SV=1 1236 1438 7.0E-17
sp|Q0RYP7|FBPC3_RHOJR Fe(3+) ions import ATP-binding protein FbpC 3 OS=Rhodococcus jostii (strain RHA1) GN=fbpC3 PE=3 SV=1 1241 1457 7.0E-17
sp|Q818I7|PSTB_BACCR Phosphate import ATP-binding protein PstB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pstB PE=3 SV=1 1224 1436 7.0E-17
sp|Q3AAA4|PSTB_CARHZ Phosphate import ATP-binding protein PstB OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pstB PE=3 SV=1 1241 1436 7.0E-17
sp|A0KPH6|ZNUC_AERHH Zinc import ATP-binding protein ZnuC OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=znuC PE=3 SV=1 1238 1451 7.0E-17
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 1266 1478 7.0E-17
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 1266 1478 7.0E-17
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 480 681 8.0E-17
sp|Q31I88|PSTB_THICR Phosphate import ATP-binding protein PstB OS=Thiomicrospira crunogena (strain XCL-2) GN=pstB PE=3 SV=1 1250 1438 8.0E-17
sp|Q89AJ0|ZNUC_BUCBP Zinc import ATP-binding protein ZnuC OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=znuC PE=3 SV=1 1238 1425 8.0E-17
sp|Q8CPA1|PSTB_STAES Phosphate import ATP-binding protein PstB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pstB PE=3 SV=1 1250 1436 8.0E-17
sp|Q5HPF5|PSTB_STAEQ Phosphate import ATP-binding protein PstB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pstB PE=3 SV=1 1250 1436 8.0E-17
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 439 671 8.0E-17
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 439 671 8.0E-17
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 439 671 8.0E-17
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 439 671 8.0E-17
sp|Q1B8V9|POTA_MYCSS Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain MCS) GN=potA PE=3 SV=1 484 679 8.0E-17
sp|A1UG51|POTA_MYCSK Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain KMS) GN=potA PE=3 SV=1 484 679 8.0E-17
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 486 667 8.0E-17
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 486 667 8.0E-17
sp|Q98FL5|PSTB_RHILO Phosphate import ATP-binding protein PstB OS=Rhizobium loti (strain MAFF303099) GN=pstB PE=3 SV=1 1233 1438 9.0E-17
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 1240 1439 9.0E-17
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 469 676 9.0E-17
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 469 676 9.0E-17
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 469 676 9.0E-17
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 485 679 1.0E-16
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 485 679 1.0E-16
sp|Q97KD5|METN_CLOAB Methionine import ATP-binding protein MetN OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metN PE=3 SV=1 1240 1438 1.0E-16
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 484 676 1.0E-16
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 484 679 1.0E-16
sp|Q87UI3|SSUB3_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB3 PE=3 SV=1 1241 1438 1.0E-16
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 1240 1428 1.0E-16
sp|Q8DRF9|METN_STRR6 Methionine import ATP-binding protein MetN OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=metN PE=3 SV=1 1239 1438 1.0E-16
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 1240 1453 1.0E-16
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 436 681 1.0E-16
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 480 681 1.0E-16
sp|Q7N545|ZNUC_PHOLL Zinc import ATP-binding protein ZnuC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=znuC PE=3 SV=2 1238 1449 1.0E-16
sp|O83658|POTA_TREPA Spermidine/putrescine import ATP-binding protein PotA OS=Treponema pallidum (strain Nichols) GN=potA PE=3 SV=1 1246 1454 1.0E-16
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 1240 1438 1.0E-16
sp|Q60AI1|POTA_METCA Spermidine/putrescine import ATP-binding protein PotA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=potA PE=3 SV=1 1246 1459 1.0E-16
sp|O34641|YTRB_BACSU ABC transporter ATP-binding protein YtrB OS=Bacillus subtilis (strain 168) GN=ytrB PE=2 SV=1 1240 1455 1.0E-16
sp|Q6D4A8|ZNUC_PECAS Zinc import ATP-binding protein ZnuC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=znuC PE=3 SV=1 1238 1449 1.0E-16
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 1245 1432 1.0E-16
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 485 667 1.0E-16
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 1240 1457 1.0E-16
sp|P19844|NOSF_PSEST Copper transport ATP-binding protein NosF OS=Pseudomonas stutzeri GN=nosF PE=3 SV=1 496 681 1.0E-16
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 485 676 1.0E-16
sp|Q87SV4|THIQ_VIBPA Thiamine import ATP-binding protein ThiQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiQ PE=3 SV=1 495 680 2.0E-16
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 1240 1451 2.0E-16
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 1240 1451 2.0E-16
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 1240 1451 2.0E-16
sp|Q9XDA6|ZURA_LISMO Zinc uptake system ATP-binding protein ZurA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=zurA PE=3 SV=1 1240 1450 2.0E-16
sp|Q12XW6|PSTB_METBU Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pstB PE=3 SV=1 1250 1453 2.0E-16
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 1252 1428 2.0E-16
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 1241 1438 2.0E-16
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 1245 1432 2.0E-16
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 1245 1432 2.0E-16
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 1245 1432 2.0E-16
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 481 698 2.0E-16
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 480 681 2.0E-16
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 478 663 2.0E-16
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 1258 1438 2.0E-16
sp|Q5WET8|PSTB1_BACSK Phosphate import ATP-binding protein PstB 1 OS=Bacillus clausii (strain KSM-K16) GN=pstB1 PE=3 SV=1 1228 1451 2.0E-16
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 485 676 2.0E-16
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 1240 1447 2.0E-16
sp|Q93DA2|METN_STRMU Methionine import ATP-binding protein MetN OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metN PE=3 SV=1 1240 1438 2.0E-16
sp|Q2RM86|PSTB_MOOTA Phosphate import ATP-binding protein PstB OS=Moorella thermoacetica (strain ATCC 39073) GN=pstB PE=3 SV=1 1250 1436 2.0E-16
sp|P9WQL3|MODC_MYCTU Molybdenum import ATP-binding protein ModC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=modC PE=1 SV=1 489 676 2.0E-16
sp|P9WQL2|MODC_MYCTO Molybdenum import ATP-binding protein ModC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=modC PE=3 SV=1 489 676 2.0E-16
sp|Q1J8E4|METN_STRPF Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=metN PE=3 SV=1 1240 1443 2.0E-16
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 1240 1447 2.0E-16
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 480 665 2.0E-16
sp|Q67RE7|PSTB2_SYMTH Phosphate import ATP-binding protein PstB 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pstB2 PE=3 SV=1 1250 1451 2.0E-16
sp|Q1GB17|POTA_LACDA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=potA PE=3 SV=2 484 679 2.0E-16
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 478 667 2.0E-16
sp|Q5M4F2|PSTB2_STRT2 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pstB2 PE=3 SV=1 1240 1436 2.0E-16
sp|Q5LZU2|PSTB2_STRT1 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pstB2 PE=3 SV=1 1240 1436 2.0E-16
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 497 663 2.0E-16
sp|Q8D3X4|PSTB2_VIBVU Phosphate import ATP-binding protein PstB 2 OS=Vibrio vulnificus (strain CMCP6) GN=pstB2 PE=3 SV=1 1250 1436 2.0E-16
sp|Q7MNI7|PSTB1_VIBVY Phosphate import ATP-binding protein PstB 1 OS=Vibrio vulnificus (strain YJ016) GN=pstB1 PE=3 SV=1 1250 1438 2.0E-16
sp|Q8DEW5|PSTB1_VIBVU Phosphate import ATP-binding protein PstB 1 OS=Vibrio vulnificus (strain CMCP6) GN=pstB1 PE=3 SV=1 1250 1438 2.0E-16
sp|Q63NI4|METN2_BURPS Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain K96243) GN=metN2 PE=3 SV=2 478 667 2.0E-16
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 1255 1438 2.0E-16
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 1241 1440 2.0E-16
sp|Q8DWR3|ECFA1_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA1 PE=3 SV=1 1252 1438 2.0E-16
sp|Q8E2L2|ECFA1_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA1 PE=3 SV=1 1252 1438 2.0E-16
sp|Q3JYF4|ECFA1_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA1 PE=3 SV=1 1252 1438 2.0E-16
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 1252 1438 2.0E-16
sp|Q87G59|PSTB2_VIBPA Phosphate import ATP-binding protein PstB 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pstB2 PE=3 SV=1 1250 1436 2.0E-16
sp|Q9PBK0|PSTB_XYLFA Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain 9a5c) GN=pstB PE=3 SV=1 1250 1438 2.0E-16
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 1240 1464 2.0E-16
sp|Q88WA5|METN1_LACPL Methionine import ATP-binding protein MetN 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN1 PE=3 SV=1 1255 1439 2.0E-16
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 1241 1440 2.0E-16
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 1241 1438 2.0E-16
sp|Q7NNG3|PSTB2_GLOVI Phosphate import ATP-binding protein PstB 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=pstB2 PE=3 SV=1 1242 1435 2.0E-16
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 1243 1467 2.0E-16
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 1241 1440 2.0E-16
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 485 676 2.0E-16
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 1241 1447 3.0E-16
sp|Q1RGD0|THIQ_ECOUT Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain UTI89 / UPEC) GN=thiQ PE=3 SV=2 490 676 3.0E-16
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 1240 1440 3.0E-16
sp|Q8NY21|METN1_STAAW Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MW2) GN=metN1 PE=3 SV=1 1240 1472 3.0E-16
sp|Q6GC27|METN1_STAAS Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MSSA476) GN=metN1 PE=3 SV=1 1240 1472 3.0E-16
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 479 668 3.0E-16
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 478 667 3.0E-16
sp|P0A193|LIVG_SALTY High-affinity branched-chain amino acid transport ATP-binding protein LivG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=livG PE=3 SV=1 483 679 3.0E-16
sp|P0A194|LIVG_SALTI High-affinity branched-chain amino acid transport ATP-binding protein LivG OS=Salmonella typhi GN=livG PE=3 SV=1 483 679 3.0E-16
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 1241 1440 3.0E-16
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 1241 1451 3.0E-16
sp|Q6D0F3|THIQ_PECAS Thiamine import ATP-binding protein ThiQ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiQ PE=3 SV=2 1261 1453 3.0E-16
sp|P46342|PSTB1_BACSU Phosphate import ATP-binding protein PstB 1 OS=Bacillus subtilis (strain 168) GN=pstB1 PE=3 SV=1 1250 1436 3.0E-16
sp|Q2GJA5|ZNUC_ANAPZ Zinc import ATP-binding protein ZnuC OS=Anaplasma phagocytophilum (strain HZ) GN=znuC PE=3 SV=2 1219 1453 3.0E-16
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 1241 1440 3.0E-16
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 485 679 3.0E-16
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 1240 1472 3.0E-16
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 1240 1472 3.0E-16
sp|Q2FJI0|METN1_STAA3 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain USA300) GN=metN1 PE=3 SV=1 1240 1472 3.0E-16
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 485 676 3.0E-16
sp|Q5X484|METN_LEGPA Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Paris) GN=metN PE=3 SV=1 1240 1438 3.0E-16
sp|P38046|NRTD_SYNE7 Nitrate transport ATP-binding protein NrtD OS=Synechococcus elongatus (strain PCC 7942) GN=nrtD PE=3 SV=1 1225 1438 3.0E-16
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 1236 1459 3.0E-16
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 1246 1426 3.0E-16
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 1246 1426 3.0E-16
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 1246 1426 3.0E-16
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 1246 1426 3.0E-16
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 1238 1459 3.0E-16
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 1240 1464 3.0E-16
sp|Q30YR3|PSTB_DESAG Phosphate import ATP-binding protein PstB OS=Desulfovibrio alaskensis (strain G20) GN=pstB PE=3 SV=1 1250 1457 3.0E-16
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 483 672 3.0E-16
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 476 679 3.0E-16
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 480 681 3.0E-16
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 1250 1457 3.0E-16
sp|P63363|PSTB1_LISMO Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB1 PE=3 SV=1 1250 1451 3.0E-16
sp|Q71WT3|PSTB1_LISMF Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB1 PE=3 SV=1 1250 1451 3.0E-16
sp|P63364|PSTB1_LISIN Phosphate import ATP-binding protein PstB 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB1 PE=3 SV=1 1250 1451 3.0E-16
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 1243 1454 3.0E-16
sp|Q13LD8|METN2_BURXL Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1 471 667 3.0E-16
sp|Q7NC40|PSTB_MYCGA Phosphate import ATP-binding protein PstB OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=pstB PE=3 SV=2 1255 1457 3.0E-16
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 1241 1447 3.0E-16
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 1245 1451 4.0E-16
sp|Q8U7G2|METN_AGRFC Methionine import ATP-binding protein MetN OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=metN PE=3 SV=3 1212 1443 4.0E-16
sp|Q8FL82|THIQ_ECOL6 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thiQ PE=3 SV=2 490 676 4.0E-16
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 1241 1459 4.0E-16
sp|Q668E1|PSTB1_YERPS Phosphate import ATP-binding protein PstB 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pstB1 PE=3 SV=1 1250 1451 4.0E-16
sp|Q1CK45|PSTB1_YERPN Phosphate import ATP-binding protein PstB 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pstB1 PE=3 SV=1 1250 1451 4.0E-16
sp|Q8ZCX5|PSTB1_YERPE Phosphate import ATP-binding protein PstB 1 OS=Yersinia pestis GN=pstB1 PE=3 SV=1 1250 1451 4.0E-16
sp|Q1C5N7|PSTB1_YERPA Phosphate import ATP-binding protein PstB 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pstB1 PE=3 SV=1 1250 1451 4.0E-16
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 1240 1571 4.0E-16
sp|Q8CRI6|ECFA1_STAES Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ecfA1 PE=3 SV=1 472 676 4.0E-16
sp|Q5HM27|ECFA1_STAEQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ecfA1 PE=3 SV=1 472 676 4.0E-16
sp|Q6W2B1|TAUB_RHISN Taurine import ATP-binding protein TauB OS=Rhizobium sp. (strain NGR234) GN=tauB PE=3 SV=2 1256 1439 4.0E-16
sp|Q6GEL4|ECFA2_STAAR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA2 PE=3 SV=1 485 676 4.0E-16
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 485 679 4.0E-16
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 486 693 4.0E-16
sp|Q04BG2|POTA_LACDB Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=potA PE=3 SV=1 484 679 4.0E-16
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 480 676 4.0E-16
sp|Q7MFE8|PSTB2_VIBVY Phosphate import ATP-binding protein PstB 2 OS=Vibrio vulnificus (strain YJ016) GN=pstB2 PE=3 SV=1 1250 1436 4.0E-16
sp|Q0TLS2|THIQ_ECOL5 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thiQ PE=3 SV=1 490 676 4.0E-16
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 1252 1439 4.0E-16
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 473 671 4.0E-16
sp|Q8ZPK4|OSMV_SALTY Osmoprotectant import ATP-binding protein OsmV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=osmV PE=1 SV=1 1254 1459 4.0E-16
sp|Q1JII9|METN_STRPD Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=metN PE=3 SV=1 1240 1443 5.0E-16
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 1258 1454 5.0E-16
sp|Q928L8|METN2_LISIN Methionine import ATP-binding protein MetN 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN2 PE=3 SV=1 477 667 5.0E-16
sp|Q8PVF6|PSTB_METMA Phosphate import ATP-binding protein PstB OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pstB PE=3 SV=1 1250 1459 5.0E-16
sp|Q7A088|ECFA2_STAAW Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MW2) GN=ecfA2 PE=3 SV=1 485 676 5.0E-16
sp|Q6G7A0|ECFA2_STAAS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA2 PE=3 SV=1 485 676 5.0E-16
sp|Q7A471|ECFA2_STAAN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain N315) GN=ecfA2 PE=1 SV=1 485 676 5.0E-16
sp|Q99S48|ECFA2_STAAM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA2 PE=3 SV=1 485 676 5.0E-16
sp|Q5HDY7|ECFA2_STAAC Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain COL) GN=ecfA2 PE=3 SV=1 485 676 5.0E-16
sp|Q2YYM5|ECFA2_STAAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA2 PE=3 SV=1 485 676 5.0E-16
sp|Q2FW35|ECFA2_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA2 PE=3 SV=1 485 676 5.0E-16
sp|Q2FER8|ECFA2_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain USA300) GN=ecfA2 PE=3 SV=1 485 676 5.0E-16
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 480 685 5.0E-16
sp|P70970|ECFA2_BACSU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus subtilis (strain 168) GN=ecfAB PE=3 SV=1 484 676 5.0E-16
sp|O34338|MNTB_BACSU Manganese transport system ATP-binding protein MntB OS=Bacillus subtilis (strain 168) GN=mntB PE=3 SV=1 1245 1451 5.0E-16
sp|Q55196|PSTB1_SYNY3 Phosphate import ATP-binding protein PstB 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pstB1 PE=3 SV=1 1250 1436 5.0E-16
sp|Q88YN5|PHNC_LACPL Phosphonates import ATP-binding protein PhnC OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=phnC PE=3 SV=1 1240 1428 5.0E-16
sp|Q74K65|POTA_LACJO Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=potA PE=3 SV=1 484 679 5.0E-16
sp|Q042G7|POTA_LACGA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=potA PE=3 SV=2 484 679 5.0E-16
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 485 679 5.0E-16
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 480 681 5.0E-16
sp|Q1AS06|POTA_RUBXD Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1 485 668 5.0E-16
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 1210 1438 5.0E-16
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 1245 1425 6.0E-16
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 1240 1434 6.0E-16
sp|Q6LY93|PSTB_METMP Phosphate import ATP-binding protein PstB OS=Methanococcus maripaludis (strain S2 / LL) GN=pstB PE=3 SV=1 1250 1436 6.0E-16
sp|Q926D8|ZURA_LISIN Zinc uptake system ATP-binding protein ZurA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=zurA PE=3 SV=1 1238 1452 6.0E-16
sp|Q12B04|METN_POLSJ Methionine import ATP-binding protein MetN OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metN PE=3 SV=1 1251 1546 6.0E-16
sp|Q5L3R0|ECFA1_GEOKA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Geobacillus kaustophilus (strain HTA426) GN=ecfA1 PE=3 SV=1 485 676 6.0E-16
sp|Q5E882|THIQ_VIBF1 Thiamine import ATP-binding protein ThiQ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thiQ PE=3 SV=1 494 680 6.0E-16
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 485 704 6.0E-16
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 1240 1457 6.0E-16
sp|Q6HDP8|PSTB_BACHK Phosphate import ATP-binding protein PstB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pstB PE=3 SV=1 1224 1436 6.0E-16
sp|Q634R8|PSTB_BACCZ Phosphate import ATP-binding protein PstB OS=Bacillus cereus (strain ZK / E33L) GN=pstB PE=3 SV=1 1224 1436 6.0E-16
sp|Q730R7|PSTB_BACC1 Phosphate import ATP-binding protein PstB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pstB PE=3 SV=1 1224 1436 6.0E-16
sp|Q81LW6|PSTB_BACAN Phosphate import ATP-binding protein PstB OS=Bacillus anthracis GN=pstB PE=3 SV=1 1224 1436 6.0E-16
sp|Q48V78|METN_STRPM Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=metN PE=3 SV=1 1240 1443 6.0E-16
sp|Q9A1E3|METN_STRP1 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M1 GN=metN PE=3 SV=1 1240 1443 6.0E-16
sp|Q0VL18|PSTB_ALCBS Phosphate import ATP-binding protein PstB OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pstB PE=3 SV=1 1241 1451 6.0E-16
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 497 663 6.0E-16
sp|Q8Y7R4|Y1207_LISMO Putative ABC transporter ATP-binding protein lmo1207 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1207 PE=3 SV=1 485 676 6.0E-16
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 1237 1457 6.0E-16
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 1241 1429 7.0E-16
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 1240 1451 8.0E-16
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 1241 1459 9.0E-16
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 1245 1425 1.0E-15
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 484 719 1.0E-15
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 484 719 1.0E-15
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 484 719 1.0E-15
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 1238 1459 1.0E-15
sp|Q8RFN2|METN_FUSNN Methionine import ATP-binding protein MetN OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=metN PE=3 SV=1 485 679 1.0E-15
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 477 679 1.0E-15
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 480 694 2.0E-15
sp|Q042G7|POTA_LACGA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=potA PE=3 SV=2 1238 1432 2.0E-15
sp|Q5E882|THIQ_VIBF1 Thiamine import ATP-binding protein ThiQ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thiQ PE=3 SV=1 1258 1441 2.0E-15
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 485 676 2.0E-15
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 481 676 2.0E-15
sp|P0C0E9|ECFA_STRPY Energy-coupling factor transporter ATP-binding protein EcfA OS=Streptococcus pyogenes GN=ecfA PE=3 SV=1 1255 1438 2.0E-15
sp|P0CZ29|ECFA1_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA1 PE=3 SV=1 1255 1438 2.0E-15
sp|A2RH11|ECFA1_STRPG Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA1 PE=3 SV=1 1255 1438 2.0E-15
sp|Q1J449|ECFA1_STRPF Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA1 PE=3 SV=2 1255 1438 2.0E-15
sp|Q1JEC8|ECFA1_STRPD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA1 PE=3 SV=2 1255 1438 2.0E-15
sp|Q7CMM7|ECFA1_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA1 PE=3 SV=2 1255 1438 2.0E-15
sp|Q5X9B5|ECFA1_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA1 PE=3 SV=2 1255 1438 2.0E-15
sp|P0CZ28|ECFA1_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA1 PE=3 SV=1 1255 1438 2.0E-15
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 1240 1451 2.0E-15
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 485 712 2.0E-15
sp|Q48QM2|ECFA1_STRPM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA1 PE=3 SV=2 1255 1438 2.0E-15
sp|Q1JJC9|ECFA1_STRPC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA1 PE=3 SV=2 1255 1438 2.0E-15
sp|P0C0E8|ECFA1_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M1 GN=ecfA1 PE=3 SV=1 1255 1438 2.0E-15
sp|Q8ZRV2|THIQ_SALTY Thiamine import ATP-binding protein ThiQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiQ PE=1 SV=1 490 676 2.0E-15
sp|Q1J982|ECFA1_STRPB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA1 PE=3 SV=2 1255 1438 3.0E-15
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 480 671 3.0E-15
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 1238 1459 3.0E-15
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 1238 1459 3.0E-15
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 1266 1440 3.0E-15
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 485 679 3.0E-15
sp|O34641|YTRB_BACSU ABC transporter ATP-binding protein YtrB OS=Bacillus subtilis (strain 168) GN=ytrB PE=2 SV=1 485 680 4.0E-15
sp|Q74K65|POTA_LACJO Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=potA PE=3 SV=1 1238 1432 4.0E-15
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 485 676 4.0E-15
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 471 679 4.0E-15
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 1255 1447 4.0E-15
sp|Q8Z9I6|THIQ_SALTI Thiamine import ATP-binding protein ThiQ OS=Salmonella typhi GN=thiQ PE=3 SV=1 490 676 5.0E-15
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 484 720 5.0E-15
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 1251 1429 6.0E-15
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 1251 1446 7.0E-15
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 478 668 7.0E-15
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 480 694 7.0E-15
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 485 678 7.0E-15
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 1246 1438 8.0E-15
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 458 679 9.0E-15
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 1245 1454 9.0E-15
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 485 679 1.0E-14
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 485 678 1.0E-14
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 1240 1459 1.0E-14
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 484 676 1.0E-14
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 485 704 1.0E-14
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 1255 1447 1.0E-14
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 485 679 2.0E-14
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 1255 1457 2.0E-14
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 480 681 2.0E-14
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 485 679 2.0E-14
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 1268 1439 2.0E-14
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 1245 1454 2.0E-14
sp|P15031|FECE_ECOLI Fe(3+) dicitrate transport ATP-binding protein FecE OS=Escherichia coli (strain K12) GN=fecE PE=2 SV=1 486 676 2.0E-14
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 485 668 2.0E-14
sp|Q5PDF8|THIQ_SALPA Thiamine import ATP-binding protein ThiQ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thiQ PE=3 SV=1 490 676 2.0E-14
sp|Q57TF5|THIQ_SALCH Thiamine import ATP-binding protein ThiQ OS=Salmonella choleraesuis (strain SC-B67) GN=thiQ PE=3 SV=1 490 676 2.0E-14
sp|Q1M8E0|METN_RHIL3 Methionine import ATP-binding protein MetN OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=metN PE=3 SV=2 452 671 2.0E-14
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 485 676 2.0E-14
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 486 668 2.0E-14
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 485 672 2.0E-14
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 486 668 2.0E-14
sp|P38046|NRTD_SYNE7 Nitrate transport ATP-binding protein NrtD OS=Synechococcus elongatus (strain PCC 7942) GN=nrtD PE=3 SV=1 476 676 2.0E-14
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 1251 1438 2.0E-14
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 477 676 3.0E-14
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 486 668 3.0E-14
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 486 668 3.0E-14
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 486 668 3.0E-14
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 485 672 3.0E-14
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 486 668 3.0E-14
sp|Q98DA2|METN_RHILO Methionine import ATP-binding protein MetN OS=Rhizobium loti (strain MAFF303099) GN=metN PE=3 SV=1 447 671 4.0E-14
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 485 668 4.0E-14
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1245 1454 4.0E-14
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 486 676 4.0E-14
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 485 679 4.0E-14
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 485 676 4.0E-14
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 486 676 4.0E-14
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 485 752 4.0E-14
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 482 679 5.0E-14
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 480 687 5.0E-14
sp|A0LUE6|POTA_ACIC1 Spermidine/putrescine import ATP-binding protein PotA OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=potA PE=3 SV=1 1247 1473 5.0E-14
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 485 676 5.0E-14
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 485 752 5.0E-14
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 482 665 7.0E-14
sp|Q6W2B1|TAUB_RHISN Taurine import ATP-binding protein TauB OS=Rhizobium sp. (strain NGR234) GN=tauB PE=3 SV=2 484 663 7.0E-14
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 470 665 7.0E-14
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 480 681 7.0E-14
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 485 676 9.0E-14
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 484 676 9.0E-14
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 485 752 1.0E-13
sp|Q1RGD0|THIQ_ECOUT Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain UTI89 / UPEC) GN=thiQ PE=3 SV=2 1260 1439 1.0E-13
sp|Q8FL82|THIQ_ECOL6 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thiQ PE=3 SV=2 1265 1439 1.0E-13
sp|Q0TLS2|THIQ_ECOL5 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thiQ PE=3 SV=1 1265 1439 1.0E-13
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 1245 1460 1.0E-13
sp|P25885|Y382_RHIME Uncharacterized ABC transporter ATP-binding protein R00382 OS=Rhizobium meliloti (strain 1021) GN=R00382 PE=3 SV=1 1246 1438 1.0E-13
sp|Q13VD7|METN1_BURXL Methionine import ATP-binding protein MetN 1 OS=Burkholderia xenovorans (strain LB400) GN=metN1 PE=3 SV=1 477 672 1.0E-13
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 478 676 1.0E-13
sp|Q8DWR3|ECFA1_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA1 PE=3 SV=1 486 669 1.0E-13
sp|Q8E2L2|ECFA1_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA1 PE=3 SV=1 486 669 1.0E-13
sp|Q3JYF4|ECFA1_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA1 PE=3 SV=1 486 669 1.0E-13
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 486 672 1.0E-13
sp|A1JRI2|ZNUC_YERE8 Zinc import ATP-binding protein ZnuC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=znuC PE=3 SV=1 486 672 2.0E-13
sp|Q3IM24|PHNC2_NATPD Phosphonates import ATP-binding protein PhnC 2 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=phnC2 PE=3 SV=1 484 673 2.0E-13
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 483 676 2.0E-13
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 478 676 2.0E-13
sp|Q03A07|METN_LACC3 Methionine import ATP-binding protein MetN OS=Lactobacillus casei (strain ATCC 334) GN=metN PE=3 SV=1 478 667 2.0E-13
sp|Q5L3R0|ECFA1_GEOKA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Geobacillus kaustophilus (strain HTA426) GN=ecfA1 PE=3 SV=1 1252 1451 2.0E-13
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 481 676 2.0E-13
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 485 676 2.0E-13
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 496 676 2.0E-13
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 480 681 2.0E-13
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 484 679 2.0E-13
sp|P33360|YEHX_ECOLI Glycine betaine uptake system ATP-binding protein YehX OS=Escherichia coli (strain K12) GN=yehX PE=1 SV=1 485 672 2.0E-13
sp|Q6A6X6|METN_PROAC Methionine import ATP-binding protein MetN OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=metN PE=3 SV=1 479 717 3.0E-13
sp|Q6GEL4|ECFA2_STAAR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA2 PE=3 SV=1 1240 1438 3.0E-13
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 480 687 3.0E-13
sp|Q6LV32|THIQ_PHOPR Thiamine import ATP-binding protein ThiQ OS=Photobacterium profundum GN=thiQ PE=3 SV=2 493 676 3.0E-13
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 486 676 3.0E-13
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 495 679 4.0E-13
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 483 679 5.0E-13
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 1235 1440 5.0E-13
sp|Q7A088|ECFA2_STAAW Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MW2) GN=ecfA2 PE=3 SV=1 1241 1438 5.0E-13
sp|Q6G7A0|ECFA2_STAAS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA2 PE=3 SV=1 1241 1438 5.0E-13
sp|Q7A471|ECFA2_STAAN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain N315) GN=ecfA2 PE=1 SV=1 1241 1438 5.0E-13
sp|Q99S48|ECFA2_STAAM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA2 PE=3 SV=1 1241 1438 5.0E-13
sp|Q5HDY7|ECFA2_STAAC Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain COL) GN=ecfA2 PE=3 SV=1 1241 1438 5.0E-13
sp|Q2YYM5|ECFA2_STAAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA2 PE=3 SV=1 1241 1438 5.0E-13
sp|Q2FW35|ECFA2_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA2 PE=3 SV=1 1241 1438 5.0E-13
sp|Q2FER8|ECFA2_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain USA300) GN=ecfA2 PE=3 SV=1 1241 1438 5.0E-13
sp|Q8Y7R4|Y1207_LISMO Putative ABC transporter ATP-binding protein lmo1207 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1207 PE=3 SV=1 1240 1426 5.0E-13
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 485 668 5.0E-13
sp|Q660M8|POTA_BORBP Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=potA PE=3 SV=1 486 679 5.0E-13
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 486 672 5.0E-13
sp|Q9L1C3|METN_STRCO Methionine import ATP-binding protein MetN OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=metN PE=3 SV=2 1255 1451 5.0E-13
sp|O51587|POTA_BORBU Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=potA PE=3 SV=1 486 679 6.0E-13
sp|Q0RYP7|FBPC3_RHOJR Fe(3+) ions import ATP-binding protein FbpC 3 OS=Rhodococcus jostii (strain RHA1) GN=fbpC3 PE=3 SV=1 486 676 7.0E-13
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 485 676 9.0E-13
sp|Q0SML1|POTA_BORAP Spermidine/putrescine import ATP-binding protein PotA OS=Borrelia afzelii (strain PKo) GN=potA PE=3 SV=1 486 679 1.0E-12
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 1258 1439 1.0E-12
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 484 676 1.0E-12
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 485 681 1.0E-12
sp|Q03ZQ0|POTA_LEUMM Spermidine/putrescine import ATP-binding protein PotA OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=potA PE=3 SV=1 486 679 1.0E-12
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 485 679 1.0E-12
sp|Q93DA2|METN_STRMU Methionine import ATP-binding protein MetN OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=metN PE=3 SV=1 479 672 1.0E-12
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 485 679 1.0E-12
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 485 676 1.0E-12
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 485 679 2.0E-12
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 482 657 2.0E-12
sp|O83658|POTA_TREPA Spermidine/putrescine import ATP-binding protein PotA OS=Treponema pallidum (strain Nichols) GN=potA PE=3 SV=1 484 679 2.0E-12
sp|Q60AI1|POTA_METCA Spermidine/putrescine import ATP-binding protein PotA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=potA PE=3 SV=1 485 671 2.0E-12
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 485 679 2.0E-12
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 481 676 2.0E-12
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 481 676 2.0E-12
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 481 676 2.0E-12
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 481 676 2.0E-12
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 481 676 2.0E-12
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 485 711 2.0E-12
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 478 671 2.0E-12
sp|Q88WA5|METN1_LACPL Methionine import ATP-binding protein MetN 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN1 PE=3 SV=1 483 676 2.0E-12
sp|Q6D0F3|THIQ_PECAS Thiamine import ATP-binding protein ThiQ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thiQ PE=3 SV=2 491 687 2.0E-12
sp|Q5X484|METN_LEGPA Methionine import ATP-binding protein MetN OS=Legionella pneumophila (strain Paris) GN=metN PE=3 SV=1 477 667 2.0E-12
sp|Q13LD8|METN2_BURXL Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1 1246 1440 2.0E-12
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 485 679 2.0E-12
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 478 662 3.0E-12
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 485 755 3.0E-12
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 487 682 3.0E-12
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 484 678 3.0E-12
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 485 668 3.0E-12
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 480 687 4.0E-12
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 482 657 4.0E-12
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 486 679 4.0E-12
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 478 662 5.0E-12
sp|Q7N545|ZNUC_PHOLL Zinc import ATP-binding protein ZnuC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=znuC PE=3 SV=2 485 672 5.0E-12
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 496 676 5.0E-12
sp|Q8CRI6|ECFA1_STAES Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ecfA1 PE=3 SV=1 1250 1428 6.0E-12
sp|Q5HM27|ECFA1_STAEQ Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ecfA1 PE=3 SV=1 1250 1428 6.0E-12
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 485 676 6.0E-12
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 1258 1439 6.0E-12
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 1235 1440 6.0E-12
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 485 672 6.0E-12
sp|P26946|Y2279_BACPE Uncharacterized ABC transporter ATP-binding protein BpOF4_11395 OS=Bacillus pseudofirmus (strain OF4) GN=BpOF4_11395 PE=3 SV=2 1271 1462 7.0E-12
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 1258 1439 7.0E-12
sp|Q6NJ07|METN_CORDI Methionine import ATP-binding protein MetN OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metN PE=3 SV=1 1246 1438 7.0E-12
sp|P0A193|LIVG_SALTY High-affinity branched-chain amino acid transport ATP-binding protein LivG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=livG PE=3 SV=1 1250 1452 7.0E-12
sp|P0A194|LIVG_SALTI High-affinity branched-chain amino acid transport ATP-binding protein LivG OS=Salmonella typhi GN=livG PE=3 SV=1 1250 1452 7.0E-12
sp|Q1CJG3|ZNUC_YERPN Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=znuC PE=3 SV=1 486 672 7.0E-12
sp|Q7CIC2|ZNUC_YERPE Zinc import ATP-binding protein ZnuC OS=Yersinia pestis GN=znuC PE=3 SV=1 486 672 7.0E-12
sp|Q1C812|ZNUC_YERPA Zinc import ATP-binding protein ZnuC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=znuC PE=3 SV=1 486 672 7.0E-12
sp|Q66AT7|ZNUC_YERPS Zinc import ATP-binding protein ZnuC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=znuC PE=3 SV=1 486 672 8.0E-12
sp|Q8G5P8|METN_BIFLO Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1 471 672 9.0E-12
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 483 676 9.0E-12
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 481 665 1.0E-11
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 1256 1425 1.0E-11
sp|Q97KD5|METN_CLOAB Methionine import ATP-binding protein MetN OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=metN PE=3 SV=1 489 712 1.0E-11
sp|P70970|ECFA2_BACSU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus subtilis (strain 168) GN=ecfAB PE=3 SV=1 1255 1450 1.0E-11
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 485 679 1.0E-11
sp|O34338|MNTB_BACSU Manganese transport system ATP-binding protein MntB OS=Bacillus subtilis (strain 168) GN=mntB PE=3 SV=1 468 662 1.0E-11
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 1258 1439 1.0E-11
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 484 676 1.0E-11
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 485 665 1.0E-11
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 495 679 1.0E-11
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 485 679 2.0E-11
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1259 1425 2.0E-11
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 471 667 2.0E-11
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 485 665 2.0E-11
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 484 676 2.0E-11
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 485 713 2.0E-11
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 485 679 2.0E-11
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 485 668 3.0E-11
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 485 668 3.0E-11
sp|Q3AAA4|PSTB_CARHZ Phosphate import ATP-binding protein PstB OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pstB PE=3 SV=1 485 667 3.0E-11
sp|Q1JII9|METN_STRPD Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=metN PE=3 SV=1 479 672 3.0E-11
sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1 1240 1455 3.0E-11
sp|Q82TL6|POTA_NITEU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=potA PE=3 SV=1 485 672 3.0E-11
sp|Q48V78|METN_STRPM Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=metN PE=3 SV=1 479 672 3.0E-11
sp|Q9A1E3|METN_STRP1 Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M1 GN=metN PE=3 SV=1 479 672 3.0E-11
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 485 665 3.0E-11
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 485 665 3.0E-11
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 485 665 3.0E-11
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 485 665 3.0E-11
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 485 679 3.0E-11
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 485 665 4.0E-11
sp|Q12B04|METN_POLSJ Methionine import ATP-binding protein MetN OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=metN PE=3 SV=1 482 671 5.0E-11
sp|P46342|PSTB1_BACSU Phosphate import ATP-binding protein PstB 1 OS=Bacillus subtilis (strain 168) GN=pstB1 PE=3 SV=1 485 678 5.0E-11
sp|P42332|BCRA_BACLI Bacitracin transport ATP-binding protein BcrA OS=Bacillus licheniformis GN=bcrA PE=3 SV=1 485 667 6.0E-11
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 1220 1447 6.0E-11
sp|Q8DRF9|METN_STRR6 Methionine import ATP-binding protein MetN OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=metN PE=3 SV=1 479 676 7.0E-11
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 1263 1433 9.0E-11
sp|Q1GB17|POTA_LACDA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=potA PE=3 SV=2 1239 1438 9.0E-11
sp|Q8U7G2|METN_AGRFC Methionine import ATP-binding protein MetN OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=metN PE=3 SV=3 485 673 1.0E-10
sp|Q818I7|PSTB_BACCR Phosphate import ATP-binding protein PstB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pstB PE=3 SV=1 485 667 1.0E-10
sp|Q9XDA6|ZURA_LISMO Zinc uptake system ATP-binding protein ZurA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=zurA PE=3 SV=1 485 660 1.0E-10
sp|Q926D8|ZURA_LISIN Zinc uptake system ATP-binding protein ZurA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=zurA PE=3 SV=1 485 660 1.0E-10
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 486 681 1.0E-10
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 486 679 1.0E-10
sp|Q87UH7|TAUB_PSESM Taurine import ATP-binding protein TauB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tauB PE=3 SV=1 1256 1439 1.0E-10
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 486 667 2.0E-10
sp|Q5SLN1|PSTB_THET8 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pstB PE=3 SV=1 485 673 2.0E-10
sp|Q89AJ0|ZNUC_BUCBP Zinc import ATP-binding protein ZnuC OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=znuC PE=3 SV=1 498 662 2.0E-10
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 484 679 2.0E-10
sp|Q1J8E4|METN_STRPF Methionine import ATP-binding protein MetN OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=metN PE=3 SV=1 479 667 2.0E-10
sp|Q2GJA5|ZNUC_ANAPZ Zinc import ATP-binding protein ZnuC OS=Anaplasma phagocytophilum (strain HZ) GN=znuC PE=3 SV=2 478 676 2.0E-10
sp|Q0AGF4|POTA_NITEC Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas eutropha (strain C91) GN=potA PE=3 SV=1 485 676 2.0E-10
sp|Q8ETV6|ECFA2_OCEIH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ecfA2 PE=3 SV=1 485 725 3.0E-10
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 485 665 3.0E-10
sp|Q6D4A8|ZNUC_PECAS Zinc import ATP-binding protein ZnuC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=znuC PE=3 SV=1 478 672 3.0E-10
sp|P0A2V9|PSTB3_STRR6 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB3 PE=1 SV=1 485 684 3.0E-10
sp|P0A2V8|PSTB3_STRPN Phosphate import ATP-binding protein PstB 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB3 PE=3 SV=1 485 684 3.0E-10
sp|Q73GK9|ZNUC_WOLPM Zinc import ATP-binding protein ZnuC OS=Wolbachia pipientis wMel GN=znuC PE=3 SV=2 495 679 5.0E-10
sp|Q04BG2|POTA_LACDB Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=potA PE=3 SV=1 1239 1438 5.0E-10
sp|Q928L8|METN2_LISIN Methionine import ATP-binding protein MetN 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN2 PE=3 SV=1 1255 1438 5.0E-10
sp|Q5M4F2|PSTB2_STRT2 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pstB2 PE=3 SV=1 485 680 5.0E-10
sp|Q5LZU2|PSTB2_STRT1 Phosphate import ATP-binding protein PstB 2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pstB2 PE=3 SV=1 485 680 5.0E-10
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 485 676 5.0E-10
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 1238 1451 6.0E-10
sp|Q63NI4|METN2_BURPS Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain K96243) GN=metN2 PE=3 SV=2 1246 1438 6.0E-10
sp|Q48CA0|SSUB3_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB3 PE=3 SV=1 496 667 6.0E-10
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 1246 1438 6.0E-10
sp|Q8NY21|METN1_STAAW Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MW2) GN=metN1 PE=3 SV=1 479 676 7.0E-10
sp|Q6GC27|METN1_STAAS Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MSSA476) GN=metN1 PE=3 SV=1 479 676 7.0E-10
sp|Q87UI3|SSUB3_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB3 PE=3 SV=1 496 667 7.0E-10
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 1246 1438 7.0E-10
sp|Q7NC40|PSTB_MYCGA Phosphate import ATP-binding protein PstB OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=pstB PE=3 SV=2 485 679 8.0E-10
sp|Q8DPC2|POTA_STRR6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=potA PE=3 SV=1 489 679 9.0E-10
sp|Q97Q42|POTA_STRPN Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=potA PE=3 SV=1 489 679 9.0E-10
sp|Q04JW0|POTA_STRP2 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=potA PE=3 SV=1 489 679 9.0E-10
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1263 1432 9.0E-10
sp|P69880|PSTB_STAAW Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain MW2) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|Q6G9H4|PSTB_STAAS Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain MSSA476) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|P69879|PSTB_STAAN Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain N315) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|P69878|PSTB_STAAM Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|P69881|PSTB_STAAC Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain COL) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|Q2FYQ0|PSTB_STAA8 Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain NCTC 8325) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|Q2FH51|PSTB_STAA3 Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain USA300) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|Q6GH21|PSTB_STAAR Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain MRSA252) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|Q2YXY2|PSTB_STAAB Phosphate import ATP-binding protein PstB OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pstB PE=3 SV=1 485 667 9.0E-10
sp|Q6GJL2|METN1_STAAR Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain MRSA252) GN=metN1 PE=3 SV=1 479 676 1.0E-09
sp|Q6HDP8|PSTB_BACHK Phosphate import ATP-binding protein PstB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pstB PE=3 SV=1 485 667 1.0E-09
sp|Q634R8|PSTB_BACCZ Phosphate import ATP-binding protein PstB OS=Bacillus cereus (strain ZK / E33L) GN=pstB PE=3 SV=1 485 667 1.0E-09
sp|Q730R7|PSTB_BACC1 Phosphate import ATP-binding protein PstB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pstB PE=3 SV=1 485 667 1.0E-09
sp|Q81LW6|PSTB_BACAN Phosphate import ATP-binding protein PstB OS=Bacillus anthracis GN=pstB PE=3 SV=1 485 667 1.0E-09
sp|Q5HIL5|METN1_STAAC Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain COL) GN=metN1 PE=3 SV=1 479 676 1.0E-09
sp|Q2G0V2|METN1_STAA8 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN1 PE=3 SV=1 479 676 1.0E-09
sp|Q2FJI0|METN1_STAA3 Methionine import ATP-binding protein MetN 1 OS=Staphylococcus aureus (strain USA300) GN=metN1 PE=3 SV=1 479 676 1.0E-09
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 486 679 1.0E-09
sp|Q24QI5|METN_DESHY Methionine import ATP-binding protein MetN OS=Desulfitobacterium hafniense (strain Y51) GN=metN PE=3 SV=1 479 671 1.0E-09
sp|Q5E3B8|PSTB2_VIBF1 Phosphate import ATP-binding protein PstB 2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pstB2 PE=3 SV=1 485 673 1.0E-09
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 489 665 2.0E-09
sp|Q72GX5|PSTB_THET2 Phosphate import ATP-binding protein PstB OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pstB PE=3 SV=1 485 673 2.0E-09
sp|Q9KU04|PSTB1_VIBCH Phosphate import ATP-binding protein PstB 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pstB1 PE=3 SV=1 485 667 2.0E-09
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 485 665 2.0E-09
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1266 1432 2.0E-09
sp|Q3ILC5|PSTB_PSEHT Phosphate import ATP-binding protein PstB OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pstB PE=3 SV=1 485 667 2.0E-09
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 489 676 3.0E-09
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1266 1432 3.0E-09
sp|Q5WET8|PSTB1_BACSK Phosphate import ATP-binding protein PstB 1 OS=Bacillus clausii (strain KSM-K16) GN=pstB1 PE=3 SV=1 485 667 3.0E-09
sp|Q85A69|CYSA_ANTFO Sulfate/thiosulfate import ATP-binding protein CysA OS=Anthoceros formosae GN=cysA PE=2 SV=1 485 679 3.0E-09
sp|A0KPH6|ZNUC_AERHH Zinc import ATP-binding protein ZnuC OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=znuC PE=3 SV=1 471 672 4.0E-09
sp|Q1R0Z6|PHNC_CHRSD Phosphonates import ATP-binding protein PhnC OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=phnC PE=3 SV=1 485 678 4.0E-09
sp|Q2RM86|PSTB_MOOTA Phosphate import ATP-binding protein PstB OS=Moorella thermoacetica (strain ATCC 39073) GN=pstB PE=3 SV=1 478 667 5.0E-09
sp|P10091|CYSA_MARPO Sulfate/thiosulfate import ATP-binding protein CysA OS=Marchantia polymorpha GN=cysA PE=3 SV=1 486 679 6.0E-09
sp|Q88YN5|PHNC_LACPL Phosphonates import ATP-binding protein PhnC OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=phnC PE=3 SV=1 485 678 6.0E-09
sp|Q1QVQ7|METN_CHRSD Methionine import ATP-binding protein MetN OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=metN PE=3 SV=1 483 665 7.0E-09
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1263 1432 8.0E-09
sp|Q9PBK0|PSTB_XYLFA Phosphate import ATP-binding protein PstB OS=Xylella fastidiosa (strain 9a5c) GN=pstB PE=3 SV=1 485 657 8.0E-09
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1263 1432 9.0E-09
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 1259 1429 1.0E-08
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1266 1432 1.0E-08
sp|Q2G607|PSTB_NOVAD Phosphate import ATP-binding protein PstB OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=pstB PE=3 SV=1 485 676 1.0E-08
sp|Q58418|PSTB_METJA Phosphate import ATP-binding protein PstB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pstB PE=3 SV=1 485 676 1.0E-08
sp|P63363|PSTB1_LISMO Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB1 PE=3 SV=1 485 667 1.0E-08
sp|Q71WT3|PSTB1_LISMF Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB1 PE=3 SV=1 485 667 1.0E-08
sp|P63364|PSTB1_LISIN Phosphate import ATP-binding protein PstB 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB1 PE=3 SV=1 485 667 1.0E-08
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1266 1432 2.0E-08
sp|Q6LY93|PSTB_METMP Phosphate import ATP-binding protein PstB OS=Methanococcus maripaludis (strain S2 / LL) GN=pstB PE=3 SV=1 485 657 2.0E-08
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 1259 1429 3.0E-08
sp|Q49XI8|PSTB_STAS1 Phosphate import ATP-binding protein PstB OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pstB PE=3 SV=1 485 667 3.0E-08
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 485 676 4.0E-08
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 485 676 4.0E-08
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 485 676 4.0E-08
sp|Q8E9I8|PSTB2_SHEON Phosphate import ATP-binding protein PstB 2 OS=Shewanella oneidensis (strain MR-1) GN=pstB2 PE=3 SV=1 497 679 5.0E-08
sp|Q4L691|PSTB_STAHJ Phosphate import ATP-binding protein PstB OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pstB PE=3 SV=1 485 667 5.0E-08
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 1259 1429 5.0E-08
sp|Q895C4|METN_CLOTE Methionine import ATP-binding protein MetN OS=Clostridium tetani (strain Massachusetts / E88) GN=metN PE=3 SV=1 486 712 5.0E-08
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 1263 1429 7.0E-08
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 1259 1429 7.0E-08
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 1259 1429 8.0E-08
sp|Q98FL5|PSTB_RHILO Phosphate import ATP-binding protein PstB OS=Rhizobium loti (strain MAFF303099) GN=pstB PE=3 SV=1 485 667 9.0E-08
sp|Q8CPA1|PSTB_STAES Phosphate import ATP-binding protein PstB OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pstB PE=3 SV=1 485 667 1.0E-07
sp|Q5HPF5|PSTB_STAEQ Phosphate import ATP-binding protein PstB OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pstB PE=3 SV=1 485 667 1.0E-07
sp|P75444|Y334_MYCPN Putative ABC transporter ATP-binding protein MPN_334 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_334 PE=3 SV=1 489 682 2.0E-07
sp|Q2KCV5|PSTB_RHIEC Phosphate import ATP-binding protein PstB OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=pstB PE=3 SV=1 478 651 2.0E-07
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 1263 1429 2.0E-07
sp|Q1MLW4|PSTB1_RHIL3 Phosphate import ATP-binding protein PstB 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=pstB1 PE=3 SV=1 478 651 2.0E-07
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 485 673 2.0E-07
sp|Q92N13|HMUV_RHIME Hemin import ATP-binding protein HmuV OS=Rhizobium meliloti (strain 1021) GN=hmuV PE=3 SV=1 1240 1415 3.0E-07
sp|Q6XYT0|PSTB_SPIKU Phosphate import ATP-binding protein PstB OS=Spiroplasma kunkelii GN=pstB PE=3 SV=1 545 667 3.0E-07
sp|Q55196|PSTB1_SYNY3 Phosphate import ATP-binding protein PstB 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pstB1 PE=3 SV=1 485 657 3.0E-07
sp|Q92SA1|PSTB_RHIME Phosphate import ATP-binding protein PstB OS=Rhizobium meliloti (strain 1021) GN=pstB PE=3 SV=1 478 651 3.0E-07
sp|Q668E1|PSTB1_YERPS Phosphate import ATP-binding protein PstB 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pstB1 PE=3 SV=1 486 665 4.0E-07
sp|Q1CK45|PSTB1_YERPN Phosphate import ATP-binding protein PstB 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pstB1 PE=3 SV=1 486 665 4.0E-07
sp|Q8ZCX5|PSTB1_YERPE Phosphate import ATP-binding protein PstB 1 OS=Yersinia pestis GN=pstB1 PE=3 SV=1 486 665 4.0E-07
sp|Q1C5N7|PSTB1_YERPA Phosphate import ATP-binding protein PstB 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pstB1 PE=3 SV=1 486 665 4.0E-07
sp|Q7MNI7|PSTB1_VIBVY Phosphate import ATP-binding protein PstB 1 OS=Vibrio vulnificus (strain YJ016) GN=pstB1 PE=3 SV=1 485 667 4.0E-07
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 480 651 4.0E-07
sp|Q8DEW5|PSTB1_VIBVU Phosphate import ATP-binding protein PstB 1 OS=Vibrio vulnificus (strain CMCP6) GN=pstB1 PE=3 SV=1 485 667 4.0E-07
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 489 665 4.0E-07
sp|Q58762|WTPC_METJA Molybdate/tungstate import ATP-binding protein WtpC OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wtpC PE=3 SV=1 486 677 5.0E-07
sp|Q2FTF8|PSTB_METHJ Phosphate import ATP-binding protein PstB OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pstB PE=3 SV=1 485 680 5.0E-07
sp|Q12XW6|PSTB_METBU Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pstB PE=3 SV=1 485 667 7.0E-07
sp|Q2W7J9|PSTB2_MAGSA Phosphate import ATP-binding protein PstB 2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=pstB2 PE=3 SV=1 485 676 7.0E-07
sp|Q8PVF6|PSTB_METMA Phosphate import ATP-binding protein PstB OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pstB PE=3 SV=1 485 657 9.0E-07
sp|Q8D3X4|PSTB2_VIBVU Phosphate import ATP-binding protein PstB 2 OS=Vibrio vulnificus (strain CMCP6) GN=pstB2 PE=3 SV=1 497 667 1.0E-06
sp|Q8UI76|PSTB_AGRFC Phosphate import ATP-binding protein PstB OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=pstB PE=3 SV=1 485 651 1.0E-06
sp|Q87G59|PSTB2_VIBPA Phosphate import ATP-binding protein PstB 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pstB2 PE=3 SV=1 497 667 1.0E-06
sp|Q6AM16|PSTB_DESPS Phosphate import ATP-binding protein PstB OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pstB PE=3 SV=1 485 676 2.0E-06
sp|Q30YR3|PSTB_DESAG Phosphate import ATP-binding protein PstB OS=Desulfovibrio alaskensis (strain G20) GN=pstB PE=3 SV=1 485 665 2.0E-06
sp|Q0VL18|PSTB_ALCBS Phosphate import ATP-binding protein PstB OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pstB PE=3 SV=1 485 651 4.0E-06
sp|Q5V0G3|PSTB2_HALMA Phosphate import ATP-binding protein PstB 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pstB2 PE=3 SV=1 485 666 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 217 239 22
3 266 288 22
4 301 323 22
5 330 348 18
6 358 375 17
7 414 431 17
8 795 817 22
9 980 1002 22
10 1022 1044 22
11 1051 1073 22
12 1088 1110 22
13 1123 1145 22
14 1165 1187 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3559
MLVAFARQLLALIHKNLLVTVVRRPIGFLLYTYGFPLAILGLLLSITSFLPTFNSFGVSPAAPIRPLGDTVDRKL
VIVRPPELGPDVDRVVEAFTQPVRRELLVFRDDEADLLSLCLPDTRGMSDCHATVLFRDSPMTGPASGRHAWRYT
IRADPARNNRNFDVKRHRSDQEDLYLPLQLAINNAITNSSVTPETVVYTPQPEQDVMEQTFNSNAAIVGRIFVFI
IIIVYSTIVYRLTAFITAERDGGMSQLIDSMGGGGSIAARVLAWLVTFDIVALPGYIGLGALYQRLVFSSSSASV
LIGWQILLGFAINSMTVFLAAFFSKSRMSAIYIIFFFFITSIIAQMYASETKPHPGQTAVFVLSLLLPSANNVYF
TQQMSLWQVDGQAAKLGQFPPETTGLWSESYGVRQSTMLSLLMLNIFIYPVLAVVVEKLRHGIHYRRRCFSAKPS
DSSGVVARTLELKKRFDPSWIKRVCCCGRRKPVMAVNGVTFQAHRGQIMCLVGPNGSGKTTTLHMMAGFIKPTEG
TIVYEARPSQIGICPQQNTLWEELTVEEHVRLWDRIKNGSRSHHELDQLIHQCDLWPKRAFKAKELSGGQKRKLQ
LACMFVGDASVCLIDECTSGLDPLSRRAIWEILVQQRSKRSIVLTTHFLDEVDVLADQIVLLAQGAVKCRGSSAE
LKNQHGGGYKVLAPLSARNICGGYPHSTHQDKLVYSVPDSRVAAQMASTLVAVGVNDVAVAGPQFEDVFLNLLGE
DEIFERSKSALTADSGFEMTPGRVTSFWTQFRVLHAKRWMVLRRFWAPYIFALIVPLGLTFLLGGMVERYTPPGC
DALQDTDPMDVPTLAFNASCLTTKEDIFPGSRGCGQVSVAPRTANASLFGLVSRRYGEMADVDPQAYGSFAVVQN
SRDEMLEYIIQNRTRAGYGGVFAGSSNEAPLIVYRIMSWGTQTGSRLLDLWSQMQGNVEINSSQEVIPKARKDAD
MNGMFYMFLFCLLQVLYPAVFVLYPAIEKARKVRAVQYSNGVRRAPLWAAYCVFDFFWICLLSILLMLIMSIRIN
FNGPVLLLIPILALYGLAATLMGYSVAHFTNGPLESYLVTLGIGMLSYMIIAISIGVSNGGVSQGEIERKMAGVA
FGANLFFPIGNLFRTLLIGFNMMEAGCKGGQPPPLGSMHGFGGPIFYLFLQICALLLLIIWLEGGLPKLHLFGKG
KPGPCNAQDFEMNSFSQGAGQARSMVAIEAARAEKAGSDLLRVLHVSKTFGTNRAVDDVTFGLPRGDVMALIGPN
GAGKSTTVNMIQAELSPDRGQIMLCQEDGRSPSSRKNLGVCPQYDAPDFMNTREHLTFYARVKGIKDVKANVGYL
MDKLGLTPHARTQASKLSGGNKRKLMLAIALMGTPPVVVLDEPTSAMDAVAKRSFWKLIQEIAAERSVLLTTHSM
EEADALATRTAIIARRLLAIGTTQSLRERYSNLYYVILVLSTAPTSSPQEMGRIGDWVRDRVAGARLEREMLGGQ
VRFTFPAGTAGIEGSKPPVASLIETLEREKEALGIDCYSISGPTLENVFLSVVRENNVEEEDGKARRHFWRRLLK
R*
Coding >Hirsu2|3559
ATGCTCGTCGCCTTCGCTCGACAGCTGTTGGCGCTGATCCACAAGAACCTGCTGGTGACGGTGGTGCGGCGCCCG
ATCGGCTTCCTCCTCTACACCTACGGCTTCCCGCTCGCCATCCTGGGCCTGCTGCTCTCGATCACGTCCTTCCTG
CCGACTTTCAACAGCTTCGGGGTCTCGCCGGCGGCGCCGATCCGGCCGCTCGGCGACACCGTCGACCGGAAGCTC
GTCATCGTCCGGCCGCCCGAGCTGGGCCCGGACGTCGACCGCGTCGTCGAGGCCTTCACCCAGCCCGTGCGGCGC
GAGCTGCTCGTCTTCCGCGATGACGAGGCCGACCTGCTGTCGCTGTGCCTGCCCGACACGCGTGGCATGAGCGAC
TGCCACGCCACCGTCCTCTTCCGCGACAGCCCGATGACGGGCCCGGCGAGCGGCCGGCACGCGTGGCGGTACACG
ATCCGGGCCGACCCGGCGCGCAACAACAGGAACTTCGACGTCAAGCGGCACCGCAGCGACCAGGAGGACCTCTAC
CTGCCGCTGCAGCTGGCCATCAACAACGCCATCACCAACTCGAGCGTGACGCCCGAGACGGTCGTCTACACGCCG
CAGCCGGAGCAGGACGTGATGGAGCAGACGTTCAACTCCAACGCGGCCATCGTGGGCCGCATCTTCGTCTTCATA
ATCATAATCGTCTATTCCACCATCGTCTACCGCCTGACGGCCTTCATCACCGCCGAGCGCGACGGCGGCATGTCC
CAGCTGATCGACTCGATGGGCGGCGGCGGCTCCATCGCGGCCCGCGTGCTCGCCTGGCTCGTCACCTTCGACATC
GTCGCCCTGCCGGGCTACATCGGCCTCGGCGCCCTGTACCAGCGTCTGGTCTTCAGCTCGTCCAGCGCCAGCGTC
CTGATCGGCTGGCAGATCCTGCTGGGCTTCGCCATCAACAGCATGACCGTCTTCCTCGCCGCCTTCTTCTCCAAG
TCGCGCATGTCCGCCATATACATCATCTTCTTCTTCTTCATCACCTCCATCATCGCCCAGATGTACGCCTCGGAG
ACGAAGCCGCACCCCGGGCAGACGGCCGTCTTCGTCCTCTCGCTCCTGCTCCCGAGTGCCAACAATGTCTATTTC
ACGCAGCAGATGAGCCTCTGGCAGGTCGACGGACAGGCCGCCAAGCTCGGCCAGTTCCCGCCGGAGACGACGGGG
CTGTGGTCCGAGTCGTACGGCGTCAGGCAGTCCACCATGCTCAGCCTCCTGATGCTCAACATCTTCATCTACCCC
GTCCTGGCCGTGGTGGTGGAGAAGCTGCGGCACGGCATCCACTACCGCAGACGGTGCTTCTCGGCCAAGCCGTCC
GACTCGTCAGGGGTCGTGGCCCGGACGCTCGAGCTCAAGAAGAGATTCGACCCCAGCTGGATCAAGCGCGTCTGC
TGCTGCGGCCGGAGGAAGCCGGTGATGGCGGTCAACGGCGTCACCTTCCAGGCGCACCGGGGCCAGATCATGTGC
CTGGTCGGGCCCAACGGCTCCGGCAAGACGACGACGCTGCACATGATGGCCGGCTTCATCAAGCCGACCGAGGGC
ACCATCGTGTACGAGGCCCGGCCGTCACAGATCGGCATCTGCCCGCAGCAGAACACGCTGTGGGAGGAGCTGACG
GTCGAGGAGCACGTCCGCCTGTGGGACAGAATCAAAAACGGGAGCCGGTCTCACCACGAGCTCGACCAGCTGATC
CACCAGTGCGACCTCTGGCCGAAGCGCGCCTTCAAGGCCAAGGAGCTCAGCGGCGGCCAGAAACGCAAGCTGCAG
CTGGCCTGCATGTTCGTCGGCGACGCCTCCGTCTGCCTCATCGACGAGTGCACCTCGGGCCTCGACCCCCTGTCC
CGGAGGGCCATCTGGGAAATCCTCGTGCAGCAGCGGTCCAAGCGCAGCATCGTGCTGACGACGCACTTCCTCGAC
GAGGTCGACGTGCTCGCCGATCAGATCGTCCTGCTGGCCCAGGGGGCCGTCAAGTGCCGCGGCTCGTCGGCCGAG
CTCAAGAACCAGCACGGCGGCGGCTACAAGGTGCTCGCGCCGCTCTCCGCCCGCAACATCTGCGGCGGCTACCCT
CACTCGACGCACCAGGACAAGCTCGTCTACAGCGTGCCCGACTCTCGCGTCGCGGCCCAGATGGCGTCGACTCTG
GTGGCCGTGGGCGTCAACGACGTCGCCGTCGCCGGGCCGCAGTTCGAAGACGTCTTCCTGAATCTCCTGGGCGAG
GACGAGATCTTCGAGCGGTCCAAGAGCGCGCTGACGGCCGACTCCGGCTTCGAAATGACGCCCGGCCGGGTCACG
TCCTTCTGGACCCAGTTCCGCGTCCTCCATGCGAAGAGATGGATGGTCCTAAGGCGCTTCTGGGCACCCTATATA
TTTGCCTTGATCGTCCCGCTCGGCCTCACCTTTCTCCTTGGCGGCATGGTGGAACGCTACACTCCGCCGGGCTGC
GATGCTTTGCAAGACACGGATCCCATGGATGTCCCTACGCTGGCGTTCAACGCGTCCTGCCTCACGACCAAGGAG
GACATTTTCCCAGGAAGCCGGGGTTGTGGTCAGGTGTCCGTGGCGCCCCGGACTGCCAACGCCAGCTTGTTCGGC
CTGGTCAGCCGCCGCTACGGGGAGATGGCTGACGTCGACCCTCAGGCGTACGGCAGCTTTGCCGTTGTGCAGAAT
TCGCGCGACGAGATGCTGGAGTACATTATCCAAAACAGAACAAGGGCCGGTTATGGCGGCGTCTTCGCCGGATCG
TCCAACGAGGCCCCCCTGATTGTCTACAGGATAATGTCGTGGGGGACCCAGACCGGGTCCAGGTTATTGGACTTG
TGGAGCCAAATGCAGGGGAACGTCGAAATCAACTCGTCCCAGGAGGTGATTCCAAAGGCCCGCAAGGATGCGGAT
ATGAACGGCATGTTCTACATGTTCTTGTTTTGCCTTCTGCAGGTCCTCTACCCGGCCGTCTTCGTTCTGTATCCC
GCCATTGAGAAGGCCCGCAAGGTCAGGGCGGTCCAGTACTCCAACGGCGTTCGGCGCGCTCCTCTCTGGGCCGCC
TACTGCGTCTTTGATTTCTTCTGGATCTGCCTCCTCTCCATCTTGCTCATGTTGATCATGTCCATAAGGATCAAT
TTCAACGGACCGGTCCTGCTGCTGATACCGATCCTGGCCCTCTACGGCCTGGCGGCCACGCTCATGGGATACAGC
GTCGCCCACTTCACGAACGGGCCCCTCGAGTCGTATCTGGTTACCTTGGGCATCGGCATGCTCTCATATATGATT
ATTGCAATCTCAATCGGAGTCAGTAACGGCGGTGTATCGCAGGGCGAGATCGAGAGGAAGATGGCGGGCGTCGCT
TTCGGCGCCAATCTGTTCTTCCCCATCGGTAACCTGTTTCGTACGCTCCTCATCGGCTTCAACATGATGGAGGCT
GGATGCAAGGGCGGCCAACCGCCGCCGCTCGGCTCCATGCACGGCTTCGGCGGCCCGATCTTTTATCTCTTTCTC
CAGATCTGTGCTCTCCTCCTCCTAATCATCTGGCTGGAGGGAGGCCTGCCGAAACTGCACCTCTTCGGCAAAGGC
AAGCCGGGTCCCTGCAACGCCCAAGACTTCGAAATGAACAGCTTCTCGCAGGGAGCGGGCCAGGCTCGGAGCATG
GTTGCGATAGAGGCGGCGCGTGCGGAAAAGGCCGGCTCCGACCTCCTGCGGGTTCTGCACGTCAGCAAGACCTTT
GGCACGAACAGGGCCGTCGACGACGTGACCTTCGGCCTGCCCCGGGGCGACGTCATGGCCCTCATCGGGCCCAAC
GGGGCCGGCAAGTCGACGACGGTGAACATGATCCAGGCCGAGTTGTCTCCGGACAGGGGACAGATCATGCTCTGC
CAGGAGGACGGCCGCTCGCCGTCGTCGAGGAAGAATCTCGGAGTGTGCCCGCAATACGATGCCCCCGACTTCATG
AACACGCGAGAACACCTCACTTTCTACGCCCGCGTCAAGGGCATCAAGGACGTCAAGGCCAACGTCGGCTATCTC
ATGGACAAGCTCGGCCTAACCCCCCACGCCAGGACACAGGCATCGAAGCTCTCGGGCGGCAACAAGCGGAAGCTG
ATGCTCGCCATCGCCCTCATGGGCACGCCGCCCGTCGTCGTCCTCGACGAGCCGACCTCGGCCATGGACGCCGTC
GCCAAACGGTCCTTCTGGAAGCTGATCCAGGAGATTGCGGCCGAGAGATCCGTTCTCCTCACTACACACAGCATG
GAAGAGGCCGACGCGCTGGCCACCCGGACGGCCATCATTGCGCGGCGCCTCCTGGCCATCGGCACAACGCAGTCC
CTGCGCGAACGATACAGCAACCTGTACTACGTCATCCTAGTGCTCTCCACGGCCCCGACCTCGTCGCCGCAGGAG
ATGGGCCGCATCGGCGACTGGGTCCGAGATCGCGTGGCAGGCGCCCGACTCGAGCGCGAGATGCTCGGCGGCCAA
GTCCGCTTCACCTTCCCGGCCGGGACGGCCGGCATCGAGGGCAGCAAGCCGCCCGTGGCGAGCCTGATCGAGACA
TTGGAGAGAGAGAAGGAGGCGCTGGGAATCGACTGCTACTCCATCAGCGGGCCGACGCTCGAGAACGTCTTCCTG
AGCGTTGTCAGGGAGAATAATGTTGAGGAGGAGGACGGGAAGGCTCGACGACATTTCTGGAGGAGGCTTCTGAAG
CGCTAG
Transcript >Hirsu2|3559
ATGCTCGTCGCCTTCGCTCGACAGCTGTTGGCGCTGATCCACAAGAACCTGCTGGTGACGGTGGTGCGGCGCCCG
ATCGGCTTCCTCCTCTACACCTACGGCTTCCCGCTCGCCATCCTGGGCCTGCTGCTCTCGATCACGTCCTTCCTG
CCGACTTTCAACAGCTTCGGGGTCTCGCCGGCGGCGCCGATCCGGCCGCTCGGCGACACCGTCGACCGGAAGCTC
GTCATCGTCCGGCCGCCCGAGCTGGGCCCGGACGTCGACCGCGTCGTCGAGGCCTTCACCCAGCCCGTGCGGCGC
GAGCTGCTCGTCTTCCGCGATGACGAGGCCGACCTGCTGTCGCTGTGCCTGCCCGACACGCGTGGCATGAGCGAC
TGCCACGCCACCGTCCTCTTCCGCGACAGCCCGATGACGGGCCCGGCGAGCGGCCGGCACGCGTGGCGGTACACG
ATCCGGGCCGACCCGGCGCGCAACAACAGGAACTTCGACGTCAAGCGGCACCGCAGCGACCAGGAGGACCTCTAC
CTGCCGCTGCAGCTGGCCATCAACAACGCCATCACCAACTCGAGCGTGACGCCCGAGACGGTCGTCTACACGCCG
CAGCCGGAGCAGGACGTGATGGAGCAGACGTTCAACTCCAACGCGGCCATCGTGGGCCGCATCTTCGTCTTCATA
ATCATAATCGTCTATTCCACCATCGTCTACCGCCTGACGGCCTTCATCACCGCCGAGCGCGACGGCGGCATGTCC
CAGCTGATCGACTCGATGGGCGGCGGCGGCTCCATCGCGGCCCGCGTGCTCGCCTGGCTCGTCACCTTCGACATC
GTCGCCCTGCCGGGCTACATCGGCCTCGGCGCCCTGTACCAGCGTCTGGTCTTCAGCTCGTCCAGCGCCAGCGTC
CTGATCGGCTGGCAGATCCTGCTGGGCTTCGCCATCAACAGCATGACCGTCTTCCTCGCCGCCTTCTTCTCCAAG
TCGCGCATGTCCGCCATATACATCATCTTCTTCTTCTTCATCACCTCCATCATCGCCCAGATGTACGCCTCGGAG
ACGAAGCCGCACCCCGGGCAGACGGCCGTCTTCGTCCTCTCGCTCCTGCTCCCGAGTGCCAACAATGTCTATTTC
ACGCAGCAGATGAGCCTCTGGCAGGTCGACGGACAGGCCGCCAAGCTCGGCCAGTTCCCGCCGGAGACGACGGGG
CTGTGGTCCGAGTCGTACGGCGTCAGGCAGTCCACCATGCTCAGCCTCCTGATGCTCAACATCTTCATCTACCCC
GTCCTGGCCGTGGTGGTGGAGAAGCTGCGGCACGGCATCCACTACCGCAGACGGTGCTTCTCGGCCAAGCCGTCC
GACTCGTCAGGGGTCGTGGCCCGGACGCTCGAGCTCAAGAAGAGATTCGACCCCAGCTGGATCAAGCGCGTCTGC
TGCTGCGGCCGGAGGAAGCCGGTGATGGCGGTCAACGGCGTCACCTTCCAGGCGCACCGGGGCCAGATCATGTGC
CTGGTCGGGCCCAACGGCTCCGGCAAGACGACGACGCTGCACATGATGGCCGGCTTCATCAAGCCGACCGAGGGC
ACCATCGTGTACGAGGCCCGGCCGTCACAGATCGGCATCTGCCCGCAGCAGAACACGCTGTGGGAGGAGCTGACG
GTCGAGGAGCACGTCCGCCTGTGGGACAGAATCAAAAACGGGAGCCGGTCTCACCACGAGCTCGACCAGCTGATC
CACCAGTGCGACCTCTGGCCGAAGCGCGCCTTCAAGGCCAAGGAGCTCAGCGGCGGCCAGAAACGCAAGCTGCAG
CTGGCCTGCATGTTCGTCGGCGACGCCTCCGTCTGCCTCATCGACGAGTGCACCTCGGGCCTCGACCCCCTGTCC
CGGAGGGCCATCTGGGAAATCCTCGTGCAGCAGCGGTCCAAGCGCAGCATCGTGCTGACGACGCACTTCCTCGAC
GAGGTCGACGTGCTCGCCGATCAGATCGTCCTGCTGGCCCAGGGGGCCGTCAAGTGCCGCGGCTCGTCGGCCGAG
CTCAAGAACCAGCACGGCGGCGGCTACAAGGTGCTCGCGCCGCTCTCCGCCCGCAACATCTGCGGCGGCTACCCT
CACTCGACGCACCAGGACAAGCTCGTCTACAGCGTGCCCGACTCTCGCGTCGCGGCCCAGATGGCGTCGACTCTG
GTGGCCGTGGGCGTCAACGACGTCGCCGTCGCCGGGCCGCAGTTCGAAGACGTCTTCCTGAATCTCCTGGGCGAG
GACGAGATCTTCGAGCGGTCCAAGAGCGCGCTGACGGCCGACTCCGGCTTCGAAATGACGCCCGGCCGGGTCACG
TCCTTCTGGACCCAGTTCCGCGTCCTCCATGCGAAGAGATGGATGGTCCTAAGGCGCTTCTGGGCACCCTATATA
TTTGCCTTGATCGTCCCGCTCGGCCTCACCTTTCTCCTTGGCGGCATGGTGGAACGCTACACTCCGCCGGGCTGC
GATGCTTTGCAAGACACGGATCCCATGGATGTCCCTACGCTGGCGTTCAACGCGTCCTGCCTCACGACCAAGGAG
GACATTTTCCCAGGAAGCCGGGGTTGTGGTCAGGTGTCCGTGGCGCCCCGGACTGCCAACGCCAGCTTGTTCGGC
CTGGTCAGCCGCCGCTACGGGGAGATGGCTGACGTCGACCCTCAGGCGTACGGCAGCTTTGCCGTTGTGCAGAAT
TCGCGCGACGAGATGCTGGAGTACATTATCCAAAACAGAACAAGGGCCGGTTATGGCGGCGTCTTCGCCGGATCG
TCCAACGAGGCCCCCCTGATTGTCTACAGGATAATGTCGTGGGGGACCCAGACCGGGTCCAGGTTATTGGACTTG
TGGAGCCAAATGCAGGGGAACGTCGAAATCAACTCGTCCCAGGAGGTGATTCCAAAGGCCCGCAAGGATGCGGAT
ATGAACGGCATGTTCTACATGTTCTTGTTTTGCCTTCTGCAGGTCCTCTACCCGGCCGTCTTCGTTCTGTATCCC
GCCATTGAGAAGGCCCGCAAGGTCAGGGCGGTCCAGTACTCCAACGGCGTTCGGCGCGCTCCTCTCTGGGCCGCC
TACTGCGTCTTTGATTTCTTCTGGATCTGCCTCCTCTCCATCTTGCTCATGTTGATCATGTCCATAAGGATCAAT
TTCAACGGACCGGTCCTGCTGCTGATACCGATCCTGGCCCTCTACGGCCTGGCGGCCACGCTCATGGGATACAGC
GTCGCCCACTTCACGAACGGGCCCCTCGAGTCGTATCTGGTTACCTTGGGCATCGGCATGCTCTCATATATGATT
ATTGCAATCTCAATCGGAGTCAGTAACGGCGGTGTATCGCAGGGCGAGATCGAGAGGAAGATGGCGGGCGTCGCT
TTCGGCGCCAATCTGTTCTTCCCCATCGGTAACCTGTTTCGTACGCTCCTCATCGGCTTCAACATGATGGAGGCT
GGATGCAAGGGCGGCCAACCGCCGCCGCTCGGCTCCATGCACGGCTTCGGCGGCCCGATCTTTTATCTCTTTCTC
CAGATCTGTGCTCTCCTCCTCCTAATCATCTGGCTGGAGGGAGGCCTGCCGAAACTGCACCTCTTCGGCAAAGGC
AAGCCGGGTCCCTGCAACGCCCAAGACTTCGAAATGAACAGCTTCTCGCAGGGAGCGGGCCAGGCTCGGAGCATG
GTTGCGATAGAGGCGGCGCGTGCGGAAAAGGCCGGCTCCGACCTCCTGCGGGTTCTGCACGTCAGCAAGACCTTT
GGCACGAACAGGGCCGTCGACGACGTGACCTTCGGCCTGCCCCGGGGCGACGTCATGGCCCTCATCGGGCCCAAC
GGGGCCGGCAAGTCGACGACGGTGAACATGATCCAGGCCGAGTTGTCTCCGGACAGGGGACAGATCATGCTCTGC
CAGGAGGACGGCCGCTCGCCGTCGTCGAGGAAGAATCTCGGAGTGTGCCCGCAATACGATGCCCCCGACTTCATG
AACACGCGAGAACACCTCACTTTCTACGCCCGCGTCAAGGGCATCAAGGACGTCAAGGCCAACGTCGGCTATCTC
ATGGACAAGCTCGGCCTAACCCCCCACGCCAGGACACAGGCATCGAAGCTCTCGGGCGGCAACAAGCGGAAGCTG
ATGCTCGCCATCGCCCTCATGGGCACGCCGCCCGTCGTCGTCCTCGACGAGCCGACCTCGGCCATGGACGCCGTC
GCCAAACGGTCCTTCTGGAAGCTGATCCAGGAGATTGCGGCCGAGAGATCCGTTCTCCTCACTACACACAGCATG
GAAGAGGCCGACGCGCTGGCCACCCGGACGGCCATCATTGCGCGGCGCCTCCTGGCCATCGGCACAACGCAGTCC
CTGCGCGAACGATACAGCAACCTGTACTACGTCATCCTAGTGCTCTCCACGGCCCCGACCTCGTCGCCGCAGGAG
ATGGGCCGCATCGGCGACTGGGTCCGAGATCGCGTGGCAGGCGCCCGACTCGAGCGCGAGATGCTCGGCGGCCAA
GTCCGCTTCACCTTCCCGGCCGGGACGGCCGGCATCGAGGGCAGCAAGCCGCCCGTGGCGAGCCTGATCGAGACA
TTGGAGAGAGAGAAGGAGGCGCTGGGAATCGACTGCTACTCCATCAGCGGGCCGACGCTCGAGAACGTCTTCCTG
AGCGTTGTCAGGGAGAATAATGTTGAGGAGGAGGACGGGAAGGCTCGACGACATTTCTGGAGGAGGCTTCTGAAG
CGCTAG
Gene >Hirsu2|3559
ATGCTCGTCGCCTTCGCTCGACAGCTGTTGGCGCTGATCCACAAGAACCTGCTGGTGACGGTGGTGCGGCGCCCG
ATCGGCTTCCTCCTCTACACCTACGGCTTCCCGCTCGCCATCCTGGGCCTGCTGCTCTCGATCACGTCCTTCCTG
CCGACTTTCAACAGCTTCGGGGTCTCGCCGGCGGCGCCGATCCGGCCGCTCGGCGACACCGTCGACCGGAAGCTC
GTCATCGTCCGGCCGCCCGAGCTGGGCCCGGACGTCGACCGCGTCGTCGAGGCCTTCACCCAGCCCGTGCGGCGC
GAGCTGCTCGTCTTCCGCGATGACGAGGCCGACCTGCTGTCGCTGTGCCTGCCCGACACGCGTGGCATGAGCGAC
TGCCACGCCACCGTCCTCTTCCGCGACAGCCCGATGACGGGCCCGGCGAGCGGCCGGCACGCGTGGCGGTACACG
ATCCGGGCCGACCCGGCGCGCAACAACAGGAACTTCGACGTCAAGCGGCACCGCAGCGACCAGGAGGACCTCTAC
CTGCCGCTGCAGCTGGCCATCAACAACGCCATCACCAACTCGAGCGTGACGCCCGAGACGGTCGTCTACACGCCG
CAGCCGGAGCAGGACGTGATGGAGCAGACGTTCAACTCCAACGCGGCCATCGTGGGCCGCATCTTCGTCTTCATA
ATCATAATCGTCTATTCCACCATCGTCTACCGCCTGACGGCCTTCATCACCGCCGAGCGCGACGGCGGCATGTCC
CAGCTGATCGACTCGATGGGCGGCGGCGGCTCCATCGCGGCCCGCGTGCTCGCCTGGCTCGTCACCTTCGACATC
GTCGCCCTGCCGGGCTACATCGGCCTCGGCGCCCTGTACCAGCGTCTGGTCTTCAGCTCGTCCAGCGCCAGCGTC
CTGATCGGCTGGCAGATCCTGCTGGGCTTCGCCATCAACAGCATGACCGTCTTCCTCGCCGCCTTCTTCTCCAAG
TCGCGCATGTCCGCCATATACATCATCTTCTTCTTCTTCATCACCTCCATCATCGCCCAGATGTACGCCTCGGAG
ACGAAGCCGCACCCCGGGCAGACGGCCGTCTTCGTCCTCTCGCTCCTGCTCCCGAGTGCCAACAATGTCTATTTC
ACGCAGCAGATGAGCCTCTGGCAGGTCGACGGACAGGCCGCCAAGCTCGGCCAGTTCCCGCCGGAGACGACGGGG
CTGTGGTCCGAGTCGTACGGCGTCAGGCAGTCCACCATGCTCAGCCTCCTGATGCTCAACATCTTCATCTACCCC
GTCCTGGCCGTGGTGGTGGAGAAGCTGCGGCACGGCATCCACTACCGCAGACGGTGCTTCTCGGCCAAGCCGTCC
GACTCGTCAGGGGTCGTGGCCCGGACGCTCGAGCTCAAGAAGAGATTCGACCCCAGCTGGATCAAGCGCGTCTGC
TGCTGCGGCCGGAGGAAGCCGGTGATGGCGGTCAACGGCGTCACCTTCCAGGCGCACCGGGGCCAGATCATGTGC
CTGGTCGGGCCCAACGGCTCCGGCAAGACGACGACGCTGCACATGATGGCCGGCTTCATCAAGCCGACCGAGGGC
ACCATCGTGTACGAGGCCCGGCCGTCACAGATCGGCATCTGCCCGCAGCAGAACACGCTGTGGGAGGAGCTGACG
GTCGAGGAGCACGTCCGCCTGTGGGACAGAATCAAAAACGGGAGCCGGTCTCACCACGAGCTCGACCAGCTGATC
CACCAGTGCGACCTCTGGCCGAAGCGCGCCTTCAAGGCCAAGGAGCTCAGCGGCGGCCAGAAACGCAAGCTGCAG
CTGGCCTGCATGTTCGTCGGCGACGCCTCCGTCTGCCTCATCGACGAGTGCACCTCGGGCCTCGACCCCCTGTCC
CGGAGGGCCATCTGGGAAATCCTCGTGCAGCAGCGGTCCAAGCGCAGCATCGTGCTGACGACGCACTTCCTCGAC
GAGGTCGACGTGCTCGCCGATCAGATCGTCCTGCTGGCCCAGGGGGCCGTCAAGTGCCGCGGCTCGTCGGCCGAG
CTCAAGAACCAGCACGGCGGCGGCTACAAGGTGCTCGCGCCGCTCTCCGCCCGCAACATCTGCGGCGGCTACCCT
CACTCGACGCACCAGGACAAGCTCGTCTACAGCGTGCCCGACTCTCGCGTCGCGGCCCAGATGGCGTCGACTCTG
GTGGCCGTGGGCGTCAACGACGTCGCCGTCGCCGGGCCGCAGTTCGAAGACGTCTTCCTGAATCTCCTGGGCGAG
GACGAGATCTTCGAGCGGTCCAAGAGCGCGCTGACGGCCGACTCCGGCTTCGAAATGACGCCCGGCCGGGTCACG
TCCTTCTGGACCCAGTTCCGCGTCCTCCATGCGAAGAGATGGATGGTCCTAAGGCGCTTCTGGGCACCCTATATA
TTTGCCTTGATCGTCCCGCTCGGCCTCACCTTTCTCCTTGGCGGCATGGTGGAACGCTACACTCCGCCGGGCTGC
GATGCTTTGCAAGACACGGATCCCATGGATGTCCCTACGCTGGCGTTCAACGCGTCCTGCCTCACGACCAAGGAG
GACATTTTCCCAGGAAGCCGGGGTTGTGGTCAGGTGTCCGTGGCGCCCCGGACTGCCAACGCCAGCTTGTTCGGC
CTGGTCAGCCGCCGCTACGGGGAGATGGCTGACGTCGACCCTCAGGCGTACGGCAGCTTTGCCGTTGTGCAGAAT
TCGCGCGACGAGATGCTGGAGTACATTATCCAAAACAGAACAAGGGCCGGTTATGGCGGCGTCTTCGCCGGATCG
TCCAACGAGGCCCCCCTGATTGTCTACAGGATAATGTCGTGGGGGACCCAGACCGGGTCCAGGTTATTGGACTTG
TGGAGCCAAATGCAGGGGAACGTCGAAATCAACTCGTCCCAGGAGGTGATTCCAAAGGCCCGCAAGGTGAGGTTA
TCTCGCACCACGTGGCGGCACGTTCAAATGCTTCGCTCTTCAGACTAAGCTGACCCAAGGATGTTCCGCCCATCA
GGATGCGGATATGAACGGCATGTTCTACATGTTCTTGTTTTGCCTTCTGCAGGTCCTCTACCCGGCCGTCTTCGT
TCTGTATCCCGCCATTGAGAAGGCCCGCAAGGTCAGGGCGGTCCAGTACTCCAACGGCGTTCGGCGCGCTCCTCT
CTGGGCCGCCTACTGCGTCTTTGATTTCTTCTGGATCTGCCTCCTCTCCATCTTGCTCATGTTGATCATGTCCAT
AAGGATCAATTTCAACGGACCGGTCCTGCTGCTGATACCGATCCTGGCCCTCTACGGCCTGGCGGCCACGCTCAT
GGGATACAGCGTCGCCCACTTCACGAACGGGCCCCTCGAGTCGTATCTGGTTACCTTGGGCATCGGCATGCTCTC
ATATATGATTATTGCAATCTCAATCGGAGTAGGAAACCTTGACTCCAACCCGAGCATGAATCTGCATTGAAAAAG
AGAGCCGAGCTAACAAGATGTGCCACGACAGGTCAGTAACGGCGGTGTATCGCAGGGCGAGATCGAGAGGAAGAT
GGCGGGCGTCGCTTTCGGCGCCAATCTGTTCTTCCCCATCGGTAACCTGTTTCGTACGCTCCTCATCGGCTTCAA
CATGATGGAGGCTGGATGCAAGGGCGGCCAACCGCCGCCGCTCGGCTCCATGCACGGCTTCGGCGGCCCGATCTT
TTATCTCTTTCTCCAGATCTGTGCTCTCCTCCTCCTAATCATCTGGCTGGAGGGAGGCCTGCCGAAACTGCACCT
CTTCGGCAAAGGCAAGCCGGGTCCCTGCAACGCCCAAGACTTCGAAATGAACAGCTTCTCGCAGGGAGCGGGCCA
GGCTCGGAGCATGGTTGCGATAGAGGCGGCGCGTGCGGAAAAGGCCGGCTCCGACCTCCTGCGGGTTCTGCACGT
CAGCAAGACCTTTGGCACGAACAGGGCCGTCGACGACGTGACCTTCGGCCTGCCCCGGGGCGACGTCATGGCCCT
CATCGGGCCCAACGGGGCCGGCAAGTCGACGACGGTGAACATGATCCAGGCCGAGTTGTCTCCGGACAGGGGACA
GATCATGCTCTGCCAGGAGGACGGCCGCTCGCCGTCGTCGAGGAAGAATCTCGGAGGTAAGTCATCGATGGTGCG
GCAGTGGGTGGAAAGACGGGCTGGCTGATGATGAATGCCTCTGCCAGTGTGCCCGCAATACGATGCCCCCGACTT
CATGAACACGCGAGAACACCTCACTTTCTACGCCCGCGTCAAGGGCATCAAGGACGTCAAGGCCAACGTCGGCTA
TCTCATGGACAAGCTCGGCCTAACCCCCCACGCCAGGACACAGGCATCGAAGCTCTCGGGCGGCAACAAGCGGAA
GCTGATGCTCGCCATCGCCCTCATGGGCACGCCGCCCGTCGTCGTCCTCGACGAGCCGACCTCGGCCATGGACGC
CGTCGCCAAACGGTCCTTCTGGAAGCTGATCCAGGAGATTGCGGCCGAGAGATCCGTTCTCCTCACTGTAAGCCG
CCGTCCCGTCATGGCCCTCGCCCCCTCCCCCCCCCTGCCTGCTCTGGCTACGTCTCCTGACAGCAGTACGTCTTC
GTCTAGACACACAGCATGGAAGAGGCCGACGCGCTGGCCACCCGGACGGCCATCATTGCGCGGCGCCTCCTGGCC
ATCGGCACAACGCAGTCCCTGCGCGAACGATACAGCAACCTGTACTACGTCATCCTAGTGCTCTCCACGGCCCCG
ACCTCGTCGCCGCAGGAGATGGGCCGCATCGGCGACTGGGTCCGAGATCGCGTGGCAGGCGCCCGACTCGAGCGC
GAGATGCTCGGCGGCCAAGTCCGCTTCACCTTCCCGGCCGGGACGGCCGGCATCGAGGGCAGCAAGCCGCCCGTG
GCGAGCCTGATCGAGACATTGGAGAGAGAGAAGGAGGCGCTGGGAATCGACTGCTACTCCATCAGCGGGCCGACG
CTCGAGAACGTCTTCCTGAGCGTTGTCAGGGAGAATAATGTTGAGGAGGAGGACGGGAAGGCTCGACGACATTTC
TGGAGGAGGCTTCTGAAGCGCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail