Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|3550
Gene name
LocationContig_1936:1875..3646
Strand-
Gene length (bp)1771
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation 1.9E-37 294 435
PF02460 Patched Patched family 1.7E-10 280 427

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 161 436 3.0E-22
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 161 436 4.0E-22
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 161 436 5.0E-21
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 172 436 2.0E-19
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 172 436 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6QM06|SCAP_BOVIN Sterol regulatory element-binding protein cleavage-activating protein OS=Bos taurus GN=SCAP PE=2 SV=1 161 436 3.0E-22
sp|Q5MNU5|SCAP_PIG Sterol regulatory element-binding protein cleavage-activating protein OS=Sus scrofa GN=SCAP PE=2 SV=2 161 436 4.0E-22
sp|Q12770|SCAP_HUMAN Sterol regulatory element-binding protein cleavage-activating protein OS=Homo sapiens GN=SCAP PE=1 SV=4 161 436 5.0E-21
sp|Q6GQT6|SCAP_MOUSE Sterol regulatory element-binding protein cleavage-activating protein OS=Mus musculus GN=Scap PE=1 SV=1 172 436 2.0E-19
sp|A2RRU4|SCAP_RAT Sterol regulatory element-binding protein cleavage-activating protein OS=Rattus norvegicus GN=Scap PE=2 SV=1 172 436 2.0E-19
sp|A0JPH4|SCAP_XENLA Sterol regulatory element-binding protein cleavage-activating protein OS=Xenopus laevis GN=scap PE=2 SV=1 39 453 4.0E-19
sp|P97260|SCAP_CRIGR Sterol regulatory element-binding protein cleavage-activating protein OS=Cricetulus griseus GN=SCAP PE=1 SV=1 161 436 8.0E-19
sp|O43043|SCAP_SCHPO Sterol regulatory element-binding protein cleavage-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scp1 PE=1 SV=1 273 462 2.0E-18
sp|O15118|NPC1_HUMAN Niemann-Pick C1 protein OS=Homo sapiens GN=NPC1 PE=1 SV=2 219 433 1.0E-10
sp|P56941|NPC1_PIG Niemann-Pick C1 protein OS=Sus scrofa GN=NPC1 PE=2 SV=1 219 433 2.0E-10
sp|O35604|NPC1_MOUSE Niemann-Pick C1 protein OS=Mus musculus GN=Npc1 PE=1 SV=2 255 433 3.0E-09
sp|Q6T3U3|NPCL1_RAT Niemann-Pick C1-like protein 1 OS=Rattus norvegicus GN=Npc1l1 PE=1 SV=1 255 447 5.0E-08
sp|Q13635|PTC1_HUMAN Protein patched homolog 1 OS=Homo sapiens GN=PTCH1 PE=1 SV=2 266 433 5.0E-07
sp|Q61115|PTC1_MOUSE Protein patched homolog 1 OS=Mus musculus GN=Ptch1 PE=1 SV=1 266 433 6.0E-07
sp|Q90693|PTC1_CHICK Protein patched homolog 1 OS=Gallus gallus GN=PTCH1 PE=1 SV=1 266 433 7.0E-07
sp|Q0EEE2|PTHD3_MOUSE Patched domain-containing protein 3 OS=Mus musculus GN=Ptchd3 PE=1 SV=1 259 431 7.0E-07
sp|Q12200|NPC1_YEAST Niemann-Pick type C-related protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCR1 PE=1 SV=1 219 431 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 39 61 22
2 270 287 17
3 302 324 22
4 336 358 22
5 373 395 22
6 402 424 22
7 469 486 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|3550
MIWYLLYPLRGTTEAPTLPTSHPLYGVFARYGRYATRHVVATLLVSAAVATILIYPIPFLFTSDYINGASNLPKH
VWTVAQPLPYDNTVEPDIIMRSMWVHASYMQALNAELLVSALELQDDLLGITKNFSPARSRRAPLTDDLLEQGMS
LSQRDAIHVANGLTPNSWFFHSPLLYWSCSRDRILADDDILSTVNDKKNQSTSANVTLRHSIVFSGKRFEDRRLL
AADALVITLLHLRDSPVGRGWERRALELPEKLYEFQFRPISMQDIASLAVAYGLTLLYFLNSLSKLRAVKSKVGL
IVTIMVQIILSVMSSFTVCAIFKIDLSRIPRAAYPLVVLAMSLEHIFRLINAVILIPFEDSVSHRIGKAFGETAP
IALASTLQNVLMLAGLSRLVSPGVSGFCVFAAIAIVFDFFYLSTFFLSVLSVDVRRMELVDALAKASMRRNPSDP
GVRGSRRSWWDPVFHGKIAMSTRIAGTIVMFGFVLLT*
Coding >Hirsu2|3550
ATGATCTGGTATCTGCTGTACCCGCTTCGAGGAACAACGGAGGCTCCCACCCTCCCTACTTCGCATCCTCTGTAC
GGCGTATTTGCTCGCTATGGCCGCTATGCCACACGTCATGTCGTCGCCACATTGCTGGTCTCGGCCGCCGTGGCC
ACCATCCTAATCTACCCTATCCCGTTTCTCTTTACTAGCGACTACATCAACGGCGCCTCAAACTTGCCCAAACAT
GTCTGGACCGTCGCCCAGCCTCTGCCGTATGACAACACTGTCGAGCCAGACATAATCATGCGCTCCATGTGGGTG
CACGCTAGCTACATGCAGGCCTTGAACGCTGAACTCCTCGTCTCAGCTCTCGAGCTCCAGGACGACCTGCTTGGC
ATCACGAAGAACTTCAGCCCCGCCCGTTCTCGCCGCGCACCCCTGACGGATGACTTGCTTGAACAAGGCATGTCG
CTGTCCCAACGAGACGCCATACATGTCGCCAACGGGCTGACCCCAAACTCGTGGTTTTTCCACTCACCCTTACTG
TATTGGAGCTGCTCGCGCGACCGCATTTTGGCCGACGATGACATCCTCTCCACCGTCAATGACAAGAAGAACCAG
TCCACATCCGCCAATGTCACTTTACGTCACTCGATTGTCTTCAGCGGCAAGCGCTTCGAGGACCGCCGTCTGCTG
GCCGCCGACGCCCTTGTCATCACACTACTCCACCTTCGCGATTCCCCTGTGGGACGTGGGTGGGAGAGAAGAGCA
CTGGAGCTTCCAGAAAAGCTCTACGAGTTTCAGTTCCGACCAATCTCAATGCAGGACATTGCCAGTCTCGCCGTC
GCATATGGCCTGACGCTGCTCTATTTTCTCAACAGTCTCTCAAAGCTCCGGGCCGTCAAGTCTAAAGTCGGCCTC
ATTGTCACCATCATGGTGCAGATAATTTTATCGGTCATGTCAAGCTTCACCGTGTGTGCTATCTTCAAAATCGAC
CTTTCACGCATCCCTCGGGCGGCCTACCCCCTCGTGGTTCTTGCCATGAGTCTTGAGCACATCTTCCGGCTCATC
AATGCCGTCATTCTCATCCCCTTCGAGGATAGCGTGAGCCACAGGATAGGCAAAGCATTCGGGGAGACTGCTCCA
ATCGCATTGGCAAGCACGCTTCAAAACGTTCTCATGCTCGCTGGTCTCTCGCGCCTGGTGTCACCGGGGGTGTCT
GGCTTTTGCGTGTTTGCTGCCATTGCGATTGTGTTCGACTTCTTTTACCTGAGCACCTTCTTCCTGTCAGTCCTC
AGTGTCGACGTACGCAGAATGGAGCTCGTCGACGCGCTTGCCAAGGCATCGATGCGACGAAACCCCAGTGACCCA
GGCGTCCGCGGCAGCCGTCGGTCCTGGTGGGACCCCGTCTTCCATGGCAAGATCGCCATGTCAACACGCATCGCG
GGCACAATTGTCATGTTTGGTTTCGTCCTCCTCACTTGA
Transcript >Hirsu2|3550
ATGATCTGGTATCTGCTGTACCCGCTTCGAGGAACAACGGAGGCTCCCACCCTCCCTACTTCGCATCCTCTGTAC
GGCGTATTTGCTCGCTATGGCCGCTATGCCACACGTCATGTCGTCGCCACATTGCTGGTCTCGGCCGCCGTGGCC
ACCATCCTAATCTACCCTATCCCGTTTCTCTTTACTAGCGACTACATCAACGGCGCCTCAAACTTGCCCAAACAT
GTCTGGACCGTCGCCCAGCCTCTGCCGTATGACAACACTGTCGAGCCAGACATAATCATGCGCTCCATGTGGGTG
CACGCTAGCTACATGCAGGCCTTGAACGCTGAACTCCTCGTCTCAGCTCTCGAGCTCCAGGACGACCTGCTTGGC
ATCACGAAGAACTTCAGCCCCGCCCGTTCTCGCCGCGCACCCCTGACGGATGACTTGCTTGAACAAGGCATGTCG
CTGTCCCAACGAGACGCCATACATGTCGCCAACGGGCTGACCCCAAACTCGTGGTTTTTCCACTCACCCTTACTG
TATTGGAGCTGCTCGCGCGACCGCATTTTGGCCGACGATGACATCCTCTCCACCGTCAATGACAAGAAGAACCAG
TCCACATCCGCCAATGTCACTTTACGTCACTCGATTGTCTTCAGCGGCAAGCGCTTCGAGGACCGCCGTCTGCTG
GCCGCCGACGCCCTTGTCATCACACTACTCCACCTTCGCGATTCCCCTGTGGGACGTGGGTGGGAGAGAAGAGCA
CTGGAGCTTCCAGAAAAGCTCTACGAGTTTCAGTTCCGACCAATCTCAATGCAGGACATTGCCAGTCTCGCCGTC
GCATATGGCCTGACGCTGCTCTATTTTCTCAACAGTCTCTCAAAGCTCCGGGCCGTCAAGTCTAAAGTCGGCCTC
ATTGTCACCATCATGGTGCAGATAATTTTATCGGTCATGTCAAGCTTCACCGTGTGTGCTATCTTCAAAATCGAC
CTTTCACGCATCCCTCGGGCGGCCTACCCCCTCGTGGTTCTTGCCATGAGTCTTGAGCACATCTTCCGGCTCATC
AATGCCGTCATTCTCATCCCCTTCGAGGATAGCGTGAGCCACAGGATAGGCAAAGCATTCGGGGAGACTGCTCCA
ATCGCATTGGCAAGCACGCTTCAAAACGTTCTCATGCTCGCTGGTCTCTCGCGCCTGGTGTCACCGGGGGTGTCT
GGCTTTTGCGTGTTTGCTGCCATTGCGATTGTGTTCGACTTCTTTTACCTGAGCACCTTCTTCCTGTCAGTCCTC
AGTGTCGACGTACGCAGAATGGAGCTCGTCGACGCGCTTGCCAAGGCATCGATGCGACGAAACCCCAGTGACCCA
GGCGTCCGCGGCAGCCGTCGGTCCTGGTGGGACCCCGTCTTCCATGGCAAGATCGCCATGTCAACACGCATCGCG
GGCACAATTGTCATGTTTGGTTTCGTCCTCCTCACTTGA
Gene >Hirsu2|3550
ATGATCTGGTATCTGCTGTACCCGCTTCGAGGGTGAGAACTGACCAGTTCCCCGCCTCCTGCCTTCATGCCTCCC
TCCCTTTGCCCGCGAGGCATAGCTAGGCACCGTTGCTACAACCCTCTTGTGGTGTCTCCAGGCCGACTGCCTACC
ACTATCGGCAGCTAACCCTCCTCCCTCCTAGAACAACGGAGGCTCCCACCCTCCCTACTTCGCATCCTCTGTACG
GCGTATTTGCTCGCTATGGCCGCTATGCCACACGTCATGTCGTCGCCACATTGCTGGTCTCGGCCGCCGTGGCCA
CCATCCTAATCTACCCTATCCCGTTTCTCTTTACTAGCGACTACATCAACGGCGCCTCAAACTTGCCCAAACATG
TCTGGACCGTCGCCCAGCCTCTGCCGTATGACAACACTGTCGAGCCAGACATAATCATGCGCTCCATGTGGGTGC
ACGCTAGCTACATGCAGGCCTTGAACGCTGAACTCCTCGTCTCAGCTCTCGAGCTCCAGGACGACCTGCTTGGCA
TCACGAAGAACTTCAGCCCCGCCCGTTCTCGCCGCGCACCCCTGACGGATGACTTGCTTGAACAAGGCATGTCGC
TGTCCCAACGAGACGCCATACATGTCGCCAACGGGCTGACCCCAAACTCGTGGTTTTTCCACTCACCCTTACTGT
ATTGGAGCTGCTCGCGCGACCGCATTTTGGCCGACGATGACATCCTCTCCACCGTCAATGACAAGAAGAACCAGT
CCACATCCGCCAATGTCACTTTACGTCACTCGATTGTCTTCAGCGGCAAGCGCTTCGAGGACCGCCGTCTGCTGG
CCGCCGACGCCCTTGTCATCACACTACTCCACCTTCGCGATTCCCCTGTGGGACGTGGGTGGGAGAGAAGAGCAC
TGGAGCTTCCAGAAAAGGTAGGAGACAAATGGAGCATATATCCCGCGGACGGTCGCGTAACTTCCAGCCAGCTCT
ACGAGTTTCAGTTCCGACCAATCTCAATGCAGGACATTGCCAGTCTCGCCGTCGCATATGGCCTGACGCTGCTCT
ATTTTCTCAACAGTCTCTCAAAGCTCCGGGCCGTCAAGTCTAAAGTCGGCCTCATTGTCACCATCATGGTGCAGA
TAATTTTATCGGTCATGTCAAGCTTCACCGTGTGTGCTATCTTCAAAATCGACCTTTCACGCATCCCTCGGGCGG
CCTACCCCCTCGTGGTTCTTGCCATGAGTCTTGAGCACATCTTCCGGCTCATCAATGCCGTCATTCTCATCCCCT
TCGAGGATAGCGTGAGCCACAGGATAGGCAAAGCATTCGGGGAGACTGCTCCAATCGCATTGGCAAGCACGCTTC
AAAACGTTCTCATGCTCGCTGGTCTCTCGCGCCTGGTGTCACCGGGGGTGTCTGGCTTTTGCGTGTTTGCTGCCA
TTGCGATTGTGTTCGACTTCTTTTACCTGAGCACCTTCTTCCTGTCAGTCCTCAGTGTCGACGTACGCAGAATGG
AGCTCGTCGACGCGCTTGCCAAGGCATCGATGCGACGAAACCCCAGTGACCCAGGCGTCCGCGGCAGCCGTCGGT
CCTGGTGGGACCCCGTCTTCCATGGCAAGATCGCCATGTCAACACGCATCGCGGGCACAATTGTCATGTTTGGTT
TCGTACTTATCGCCCAGTGGCATTTTTTTGGAGATGAGGGCTTGTTCCGAAAAATCCTGCGACTTTACAAGTGGG
CCGACCCCCAGCTGGCACTCGGGCGCTCCAGGTCCTCCTCACTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail