Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|355
Gene name
LocationContig_1069:6982..8883
Strand+
Gene length (bp)1901
Transcript length (bp)1440
Coding sequence length (bp)1440
Protein length (aa) 480

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 1.5E-22 37 198
PF03188 Cytochrom_B561 Eukaryotic cytochrome b561 1.2E-06 257 354
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.4E-05 230 317

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 230 252 22
2 265 287 22
3 297 316 19
4 335 357 22
5 361 383 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|355
MLLDLFWRAALAATAATVAGSPPAAAAQDDDGGQSTFVSPGGDLAFGFTVPDNGNSDVFFSLRVPVENAWGAVGL
GSDDMKGALFLVIYRDESGRNVTFSPRLAYGNYEPQYYPDLRVEVLPGTGVVDGHMLFTARCTDHCRSWPAADSN
SGYIDVTSPNQKAIYALGPRDGFRSNDPAADVKFHREFGVFTIDMKRTQGSPDAPVLSAASRSLGAELDYRRTGR
ADYKAVLHATFMVVFLLVMFPLGVALLRLGRWARWHGLNQAVAVVGVLAGLAMGILASFHYQRSRGFRSHHQILG
FIVVAFVLAQFALGLLHHQEHRKTQAPTRYSKVHVWLGRLIIFLGTLNAFFGFTFALNRKVGMALAGLIILGAFA
LMFFSVGRQWLAKKNQRRDATNPRHGAPAGYQPQPWREPGQGPGPSGMPYPSEPPPGYEPPSQQIGLQPVSTSPA
AASPWKSSDAKDFEDDPALGSTHRPREFA*
Coding >Hirsu2|355
ATGCTGCTCGACTTGTTCTGGCGCGCGGCGCTGGCTGCCACAGCAGCCACCGTCGCGGGCTCGCCCCCGGCGGCC
GCGGCCCAAGATGACGACGGCGGCCAGTCGACCTTCGTCTCGCCCGGCGGCGACCTCGCCTTCGGCTTCACGGTG
CCCGACAACGGCAACTCGGACGTCTTCTTCAGCCTGCGCGTGCCGGTCGAGAACGCGTGGGGCGCCGTCGGGCTC
GGCAGCGACGACATGAAGGGCGCCCTCTTCCTCGTCATCTACCGCGACGAGAGCGGCCGCAACGTCACCTTCTCG
CCGCGCCTCGCCTACGGCAACTACGAGCCCCAGTACTACCCGGACCTCCGCGTCGAGGTGCTGCCCGGCACCGGC
GTCGTCGACGGCCACATGCTCTTCACCGCCCGCTGCACCGACCACTGCCGCAGCTGGCCCGCCGCCGACTCCAAC
AGCGGCTACATCGACGTCACCTCGCCCAACCAAAAGGCCATCTACGCCCTCGGCCCGCGCGACGGCTTCCGCAGC
AACGACCCGGCCGCCGACGTCAAGTTCCACCGCGAGTTCGGCGTCTTCACCATCGACATGAAGCGCACCCAGGGC
TCCCCCGACGCCCCCGTCCTGTCCGCCGCCTCCCGCAGTCTCGGCGCCGAGCTCGACTACCGCCGCACCGGCCGC
GCCGACTACAAGGCCGTCCTGCACGCCACCTTCATGGTCGTCTTTCTGCTCGTCATGTTCCCCCTCGGCGTCGCC
CTCCTCCGCCTCGGCCGCTGGGCCCGCTGGCACGGCCTCAACCAGGCCGTCGCCGTCGTCGGCGTCCTCGCCGGC
CTCGCCATGGGCATCCTCGCCAGCTTCCACTATCAGAGGTCGAGAGGCTTCCGCTCTCACCACCAAATCCTCGGC
TTCATCGTCGTCGCCTTCGTCCTAGCTCAGTTCGCCCTCGGCCTCCTCCACCACCAGGAGCACCGCAAGACCCAG
GCACCTACCAGGTACAGCAAGGTGCACGTCTGGCTGGGAAGGCTCATCATCTTCCTCGGCACCCTCAACGCCTTC
TTCGGCTTTACCTTTGCCCTCAACCGCAAGGTGGGCATGGCGCTGGCCGGCCTCATCATCCTCGGCGCCTTCGCC
CTCATGTTCTTCTCCGTCGGGCGGCAATGGCTTGCCAAGAAGAACCAGCGCCGTGACGCCACCAATCCGCGCCAC
GGCGCGCCTGCGGGGTACCAACCGCAGCCGTGGCGCGAGCCTGGCCAGGGCCCCGGCCCGTCGGGCATGCCCTAT
CCGTCCGAGCCGCCGCCGGGGTACGAGCCGCCATCGCAGCAGATTGGCCTGCAGCCCGTATCGACGTCGCCCGCC
GCGGCCTCGCCCTGGAAGAGCTCCGATGCCAAGGACTTCGAGGACGACCCCGCTCTCGGGAGCACGCATCGGCCG
CGAGAGTTTGCGTAA
Transcript >Hirsu2|355
ATGCTGCTCGACTTGTTCTGGCGCGCGGCGCTGGCTGCCACAGCAGCCACCGTCGCGGGCTCGCCCCCGGCGGCC
GCGGCCCAAGATGACGACGGCGGCCAGTCGACCTTCGTCTCGCCCGGCGGCGACCTCGCCTTCGGCTTCACGGTG
CCCGACAACGGCAACTCGGACGTCTTCTTCAGCCTGCGCGTGCCGGTCGAGAACGCGTGGGGCGCCGTCGGGCTC
GGCAGCGACGACATGAAGGGCGCCCTCTTCCTCGTCATCTACCGCGACGAGAGCGGCCGCAACGTCACCTTCTCG
CCGCGCCTCGCCTACGGCAACTACGAGCCCCAGTACTACCCGGACCTCCGCGTCGAGGTGCTGCCCGGCACCGGC
GTCGTCGACGGCCACATGCTCTTCACCGCCCGCTGCACCGACCACTGCCGCAGCTGGCCCGCCGCCGACTCCAAC
AGCGGCTACATCGACGTCACCTCGCCCAACCAAAAGGCCATCTACGCCCTCGGCCCGCGCGACGGCTTCCGCAGC
AACGACCCGGCCGCCGACGTCAAGTTCCACCGCGAGTTCGGCGTCTTCACCATCGACATGAAGCGCACCCAGGGC
TCCCCCGACGCCCCCGTCCTGTCCGCCGCCTCCCGCAGTCTCGGCGCCGAGCTCGACTACCGCCGCACCGGCCGC
GCCGACTACAAGGCCGTCCTGCACGCCACCTTCATGGTCGTCTTTCTGCTCGTCATGTTCCCCCTCGGCGTCGCC
CTCCTCCGCCTCGGCCGCTGGGCCCGCTGGCACGGCCTCAACCAGGCCGTCGCCGTCGTCGGCGTCCTCGCCGGC
CTCGCCATGGGCATCCTCGCCAGCTTCCACTATCAGAGGTCGAGAGGCTTCCGCTCTCACCACCAAATCCTCGGC
TTCATCGTCGTCGCCTTCGTCCTAGCTCAGTTCGCCCTCGGCCTCCTCCACCACCAGGAGCACCGCAAGACCCAG
GCACCTACCAGGTACAGCAAGGTGCACGTCTGGCTGGGAAGGCTCATCATCTTCCTCGGCACCCTCAACGCCTTC
TTCGGCTTTACCTTTGCCCTCAACCGCAAGGTGGGCATGGCGCTGGCCGGCCTCATCATCCTCGGCGCCTTCGCC
CTCATGTTCTTCTCCGTCGGGCGGCAATGGCTTGCCAAGAAGAACCAGCGCCGTGACGCCACCAATCCGCGCCAC
GGCGCGCCTGCGGGGTACCAACCGCAGCCGTGGCGCGAGCCTGGCCAGGGCCCCGGCCCGTCGGGCATGCCCTAT
CCGTCCGAGCCGCCGCCGGGGTACGAGCCGCCATCGCAGCAGATTGGCCTGCAGCCCGTATCGACGTCGCCCGCC
GCGGCCTCGCCCTGGAAGAGCTCCGATGCCAAGGACTTCGAGGACGACCCCGCTCTCGGGAGCACGCATCGGCCG
CGAGAGTTTGCGTAA
Gene >Hirsu2|355
ATGCTGCTCGACTTGTTCTGGCGCGCGGCGCTGGCTGCCACAGGTGCGATCTCTGAGCGAACCCCTCCTCTTGCT
CCTCCTCCTCCACCGCCAAGGGCCCCATCGTGGCTTTGATGCGGGGACGCTTTTGCCAACGTCATCCCTGTCTCT
TCCTCCTTTTCCGAGCTCCTTGTCTCCCTCCTGCTCCTGCTCCTGCTCCTGCTCCTCGTCCTCCTGCTGCTCCTC
TTCCTTCTCCTCCTCCACGATGCCTCCTCCTCCACGATGCTTCCCTCTGCAGCACGCAAAGCTGGTCCCTTGATT
TGCCGTCGTCGTTCGCCTGCTGACGGACGAGAGCACACGGCCTACAGCAGCCACCGTCGCGGGCTCGCCCCCGGC
GGCCGCGGCCCAAGATGACGACGGCGGCCAGTCGACCTTCGTCTCGCCCGGCGGCGACCTCGCCTTCGGCTTCAC
GGTGCCCGACAACGGCAACTCGGACGTCTTCTTCAGCCTGCGCGTGCCGGTCGAGAACGCGTGGGGCGCCGTCGG
GCTCGGCAGCGACGACATGAAGGGCGCCCTCTTCCTCGTCATCTACCGCGACGAGAGCGGCCGCAACGTCACCTT
CTCGCCGCGCCTCGCCTACGGCAACTACGAGCCCCAGTACTACCCGGACCTCCGCGTCGAGGTGCTGCCCGGCAC
CGGCGTCGTCGACGGCCACATGCTCTTCACCGCCCGCTGCACCGACCACTGCCGCAGCTGGCCCGCCGCCGACTC
CAACAGCGGCTACATCGACGTCACCTCGCCCAACCAAAAGGCCATCTACGCCCTCGGCCCGCGCGACGGCTTCCG
CAGCAACGACCCGGCCGCCGACGTCAAGTTCCACCGCGAGTTCGGCGTCTTCACCATCGACATGAAGCGCACCCA
GGGCTCCCCCGACGCCCCCGTCCTGTCCGCCGCCTCCCGCAGTCTCGGCGCCGAGCTCGACTACCGCCGCACCGG
CCGCGCCGACTACAAGGCCGTCCTGCACGCCACCTTCATGGTCGTCTTTCTGCTCGTCATGTTCCCCCTCGGCGT
CGCCCTCCTCCGCCTCGGCCGCTGGGCCCGCTGGCACGGCCTCAACCAGGCCGTCGCCGTCGTCGGCGTCCTCGC
CGGCCTCGCCATGGGCATCCTCGCCAGCTTCCACTATCAGAGGGTCCGTCACTCGTCTTCTCCCCCCCCCTTCCC
CTTTGCGCTTGCCCCCGTGAATGTTGACTGACGGACGCCATCCCCCCCGTCCCCAGTCGAGAGGCTTCCGCTCTC
ACCACCAAATCCTCGGCTTCATCGTCGTCGCCTTCGTCCTAGCTCAGTTCGCCCTCGGCCTCCTCCACCACCAGG
AGCACCGCAAGACCCAGGCACCTACCAGGTACAGCAAGGTGCACGTCTGGCTGGGAAGGCTCATCATCTTCCTCG
GCACCCTCAACGCCTTCTTGTACGTCCGGTCCTGGACCGACCCCCTCTCTCCTCCCCAACCCCACGCGCTGACCG
CCCGCCCTCGCAGCGGCTTTACCTTTGCCCTCAACCGCAAGGTGGGCATGGCGCTGGCCGGCCTCATCATCCTCG
GCGCCTTCGCCCTCATGTTCTTCTCCGTCGGGCGGCAATGGCTTGCCAAGAAGAACCAGCGCCGTGACGCCACCA
ATCCGCGCCACGGCGCGCCTGCGGGGTACCAACCGCAGCCGTGGCGCGAGCCTGGCCAGGGCCCCGGCCCGTCGG
GCATGCCCTATCCGTCCGAGCCGCCGCCGGGGTACGAGCCGCCATCGCAGCAGATTGGCCTGCAGCCCGTATCGA
CGTCGCCCGCCGCGGCCTCGCCCTGGAAGAGCTCCGATGCCAAGGACTTCGAGGACGACCCCGCTCTCGGGAGCA
CGCATCGGCCGCGAGAGTTTGCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail