Protein ID | Hirsu2|3542 |
Gene name | |
Location | Contig_1931:3697..4033 |
Strand | + |
Gene length (bp) | 336 |
Transcript length (bp) | 213 |
Coding sequence length (bp) | 213 |
Protein length (aa) | 71 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00172 | Zn_clus | Fungal Zn(2)-Cys(6) binuclear cluster domain | 3.3E-09 | 28 | 61 |
GO Term | Description | Terminal node |
---|---|---|
GO:0000981 | DNA-binding transcription factor activity, RNA polymerase II-specific | Yes |
GO:0006355 | regulation of transcription, DNA-templated | Yes |
GO:0008270 | zinc ion binding | Yes |
GO:0009889 | regulation of biosynthetic process | No |
GO:0050789 | regulation of biological process | No |
GO:0008150 | biological_process | No |
GO:0010468 | regulation of gene expression | No |
GO:0005488 | binding | No |
GO:2001141 | regulation of RNA biosynthetic process | No |
GO:0050794 | regulation of cellular process | No |
GO:0031323 | regulation of cellular metabolic process | No |
GO:0019219 | regulation of nucleobase-containing compound metabolic process | No |
GO:0051252 | regulation of RNA metabolic process | No |
GO:0140110 | transcription regulator activity | No |
GO:0010556 | regulation of macromolecule biosynthetic process | No |
GO:1903506 | regulation of nucleic acid-templated transcription | No |
GO:0019222 | regulation of metabolic process | No |
GO:0003700 | DNA-binding transcription factor activity | No |
GO:0031326 | regulation of cellular biosynthetic process | No |
GO:0043169 | cation binding | No |
GO:0065007 | biological regulation | No |
GO:0043167 | ion binding | No |
GO:0046872 | metal ion binding | No |
GO:0051171 | regulation of nitrogen compound metabolic process | No |
GO:0060255 | regulation of macromolecule metabolic process | No |
GO:0003674 | molecular_function | No |
GO:0046914 | transition metal ion binding | No |
GO:0080090 | regulation of primary metabolic process | No |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Nucleus | Nuclear localization signal | 0.4525 | 0.8077 | 0.1818 | 0.0442 | 0.1332 | 0.002 | 0.0841 | 0.034 | 0.031 | 0.0025 |
Transcription Factor Class (based on PFAM domains) |
---|
Fungal Specific TF |
Orthofinder run ID | 4 |
Orthogroup | 7471 |
Change Orthofinder run |
Species | Protein ID |
---|---|
Ophiocordyceps subramaniannii | Hirsu2|1056 |
Ophiocordyceps subramaniannii | Hirsu2|3542 (this protein) |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|3542 MSASAASAAKMTKASNLRKRRFPYTQIACDECRRRKIKCTGENPCKGCRDIDAVCLFERQTRFRSADRRG* |
Coding | >Hirsu2|3542 ATGTCCGCTTCCGCCGCTTCCGCCGCCAAGATGACCAAGGCGTCGAACCTGCGGAAGAGGCGGTTTCCCTACACG CAGATTGCCTGCGACGAGTGCCGACGACGAAAGATCAAGTGTACGGGCGAGAACCCGTGCAAGGGCTGCCGCGAC ATCGATGCCGTCTGTCTGTTCGAGCGCCAGACGCGCTTCCGATCCGCCGACCGGCGCGGGTGA |
Transcript | >Hirsu2|3542 ATGTCCGCTTCCGCCGCTTCCGCCGCCAAGATGACCAAGGCGTCGAACCTGCGGAAGAGGCGGTTTCCCTACACG CAGATTGCCTGCGACGAGTGCCGACGACGAAAGATCAAGTGTACGGGCGAGAACCCGTGCAAGGGCTGCCGCGAC ATCGATGCCGTCTGTCTGTTCGAGCGCCAGACGCGCTTCCGATCCGCCGACCGGCGCGGGTGA |
Gene | >Hirsu2|3542 ATGTCCGCTTCCGCCGCTTCCGCCGCCAAGATGACCAAGGCGTCGAACCTGCGGAAGAGGCGGTTTCCCTACACG CAGATTGCCTGGTCCGTCCCTCTCGTCAGCGGCTTTTTTTTTTTTTTTTGATTGCCATCTTTTTTGTCCGGAACT TGGCCTGCTTTCGTCTCAATGGCAAGCGATCGGACCGTGGTCTAACCGGCCAGCGACAGCGACGAGTGCCGACGA CGAAAGATCAAGTGTACGGGCGAGAACCCGTGCAAGGGCTGCCGCGACATCGATGCCGTCTGTCTGTTCGAGCGC CAGACGCGCTTCCGATCCGCCGACCGGCGCGGGTGA |