Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|354
Gene name
LocationContig_1069:4385..5471
Strand+
Gene length (bp)1086
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 13 303 4.0E-88
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 30 291 3.0E-60
sp|Q93XX5|Y5713_ARATH PI-PLC X domain-containing protein At5g67130 OS=Arabidopsis thaliana GN=At5g67130 PE=1 SV=1 21 303 1.0E-10
sp|Q8CHS4|PLCX1_MOUSE PI-PLC X domain-containing protein 1 OS=Mus musculus GN=Plcxd1 PE=2 SV=1 68 206 1.0E-06
sp|Q9NUJ7|PLCX1_HUMAN PI-PLC X domain-containing protein 1 OS=Homo sapiens GN=PLCXD1 PE=2 SV=1 69 206 2.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2439 0.0648 0.8759 0.1962 0.1085 0.0136 0.5571 0.4855 0.3685 0.003

SignalP

SignalP signal predicted Location Score
Yes 1 - 27 0.999765

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2463
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3441
Ophiocordyceps australis map64 (Brazil) OphauB2|7130
Ophiocordyceps camponoti-floridani Ophcf2|05453
Ophiocordyceps camponoti-rufipedis Ophun1|5174
Ophiocordyceps kimflemingae Ophio5|5401
Ophiocordyceps subramaniannii Hirsu2|354 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|354
MGVMPRLGPLAALVLCAVALVCVGASAVAPRAAARCNGHEKLCGRRYSNVTMIGTHNSAFVGDTPFHNQFVTVTE
QLDMGVRFLQAQTHNKDDTIELCHTSCLELDVGPLTDYLQELADWMKGHADEVVTLLLTNIDAIPLDKFDAAVGS
VGLKKYLYHPRGVVPKDQWPTLQELIKAGTRLIIFMDYHTDQSQFDYLINEFDYFWETPYGITDKNFPTCNVDRP
SGGDANRLMGIMNHMLNFQIGRIVFPNMIDAATTNSVASIQRQVDLCKSQGKAQPNVVLLDWVNIGEARKAHEVL
NAL*
Coding >Hirsu2|354
ATGGGCGTGATGCCACGCCTCGGCCCGCTGGCCGCCCTCGTCCTGTGCGCCGTCGCGCTGGTCTGCGTCGGCGCC
TCGGCCGTCGCCCCGCGGGCGGCGGCGCGCTGCAACGGGCACGAGAAGCTGTGCGGGCGGCGCTACTCCAACGTC
ACCATGATCGGGACGCACAACAGCGCCTTCGTCGGCGACACGCCCTTCCACAACCAGTTCGTGACGGTGACGGAG
CAGCTGGACATGGGCGTGCGCTTCCTGCAGGCGCAGACGCACAACAAGGACGACACCATCGAGCTGTGCCACACG
TCGTGCCTCGAGCTCGACGTCGGGCCGCTGACCGACTACCTCCAGGAGCTGGCCGACTGGATGAAGGGCCACGCC
GACGAGGTCGTGACCCTGCTGCTGACCAACATCGACGCCATCCCGCTCGACAAGTTCGACGCCGCCGTCGGCAGC
GTCGGCCTCAAGAAGTACCTCTACCACCCGCGCGGCGTCGTGCCCAAGGACCAGTGGCCGACGCTGCAGGAGCTC
ATCAAGGCCGGCACCCGTCTGATTATCTTTATGGACTACCACACGGACCAGTCGCAGTTCGACTACCTGATCAAC
GAGTTCGACTACTTCTGGGAGACGCCGTACGGCATCACGGACAAGAACTTCCCGACCTGCAACGTCGACCGGCCG
TCGGGCGGCGACGCCAACCGGCTGATGGGCATCATGAACCACATGCTCAACTTCCAGATCGGCAGGATCGTCTTC
CCCAACATGATTGACGCGGCCACGACCAACTCGGTCGCCTCGATCCAGCGGCAGGTAGACCTCTGCAAGAGCCAG
GGCAAGGCGCAGCCGAACGTCGTCTTGCTCGACTGGGTCAACATCGGCGAGGCGCGAAAGGCCCACGAGGTTCTC
AACGCGCTGTAG
Transcript >Hirsu2|354
ATGGGCGTGATGCCACGCCTCGGCCCGCTGGCCGCCCTCGTCCTGTGCGCCGTCGCGCTGGTCTGCGTCGGCGCC
TCGGCCGTCGCCCCGCGGGCGGCGGCGCGCTGCAACGGGCACGAGAAGCTGTGCGGGCGGCGCTACTCCAACGTC
ACCATGATCGGGACGCACAACAGCGCCTTCGTCGGCGACACGCCCTTCCACAACCAGTTCGTGACGGTGACGGAG
CAGCTGGACATGGGCGTGCGCTTCCTGCAGGCGCAGACGCACAACAAGGACGACACCATCGAGCTGTGCCACACG
TCGTGCCTCGAGCTCGACGTCGGGCCGCTGACCGACTACCTCCAGGAGCTGGCCGACTGGATGAAGGGCCACGCC
GACGAGGTCGTGACCCTGCTGCTGACCAACATCGACGCCATCCCGCTCGACAAGTTCGACGCCGCCGTCGGCAGC
GTCGGCCTCAAGAAGTACCTCTACCACCCGCGCGGCGTCGTGCCCAAGGACCAGTGGCCGACGCTGCAGGAGCTC
ATCAAGGCCGGCACCCGTCTGATTATCTTTATGGACTACCACACGGACCAGTCGCAGTTCGACTACCTGATCAAC
GAGTTCGACTACTTCTGGGAGACGCCGTACGGCATCACGGACAAGAACTTCCCGACCTGCAACGTCGACCGGCCG
TCGGGCGGCGACGCCAACCGGCTGATGGGCATCATGAACCACATGCTCAACTTCCAGATCGGCAGGATCGTCTTC
CCCAACATGATTGACGCGGCCACGACCAACTCGGTCGCCTCGATCCAGCGGCAGGTAGACCTCTGCAAGAGCCAG
GGCAAGGCGCAGCCGAACGTCGTCTTGCTCGACTGGGTCAACATCGGCGAGGCGCGAAAGGCCCACGAGGTTCTC
AACGCGCTGTAG
Gene >Hirsu2|354
ATGGGCGTGATGCCACGCCTCGGCCCGCTGGCCGCCCTCGTCCTGTGCGCCGTCGCGCTGGTCTGCGTCGGCGCC
TCGGCCGTCGCCCCGCGGGCGGCGGCGCGCTGCAACGGGCACGAGAAGCTGTGCGGGCGGCGCTACTCCAACGTC
ACCATGATCGGGACGCACAACAGCGCCTTCGTCGGCGACACGCCCTTCCACAACCAGTTCGTGACGGTGACGGAG
CAGCTGGACATGGGCGTGCGCTTCCTGCAGGCGCAGACGCACAACAAGGACGACACCATCGAGCTGTGCCACACG
TCGTGCCTCGAGCTCGACGTCGGGCCGCTGACCGACTACCTCCAGGAGCTGGCCGACTGGATGAAGGGCCACGCC
GACGAGGTCGTGACCCTGCTGCTGACCAACATCGACGCCATCCCGCTCGACAAGTTCGACGCCGCCGTCGGCAGC
GTCGGCCTCAAGAAGTACCTCTACCACCCGCGCGGCGTCGTGCCCAAGGACCAGTGGCCGACGCTGCAGGAGCTC
ATCAAGGCCGGCACCCGTCTGATTATCTTTATGGGTGAGTCGCGCCCTCCGTCATCTGGCCAGGCTCTCTCGCTC
GCCCCGGACGGAAAGGCTGACGGCGCCGGCAGACTACCACACGGACCAGTCGCAGTTCGACTACCTGATCAACGA
GTTCGACTACTTCTGGGAGACGCCGTACGGCATCACGGACAAGAACTTCCCGACCTGCAACGTCGACCGGCCGTC
GGGCGGCGACGCCAACCGGCTGATGGGCATCATGAACCACATGCTCAACTTCCAGATCGGCAGGATCGTCTTCCC
CAACATGATTGACGCGGCCACGACCAACTCGGTCGCCTCGATCCAGCGGCAGGTAGACCTCTGCAAGAGCCAGGG
CAAGGCGCAGCCGAACGTCGTCTTGGTGAGTGGAGGAAACCGGTCACGAGGGCCGAGGCGCGAGAGGGCGTGGAG
AGGGAGGGAGAGAGAGAGAGAAAGAGAGAGGCTAACTTCGTCTTTGCGCAGCTCGACTGGGTCAACATCGGCGAG
GCGCGAAAGGCCCACGAGGTTCTCAACGCGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail